-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ACP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-158 of human ACP1 (NP_009030.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against ACP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-158 of human ACP1 (NP_009030.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-02348A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ACP1 |
| Target Synonyms | HAAP; LMWPTP; LMW-PTP; ACP1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-158 of human ACP1 (NP_009030.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH | Uniprot ID | P24666 |
Uniprot Id
P24666
Target Species
Human
Target Name
ACP1
Target Full Name
Low molecular weight phosphotyrosine protein phosphatase
Target Function
Acts on tyrosine phosphorylated proteins, low-MW aryl phosphates and natural and synthetic acyl phosphates. Isoform 3 does not possess phosphatase activity.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Low molecular weight phosphotyrosine protein phosphatase family
Target Tissue Specificity
T-lymphocytes express only isoform 2.
Target Research Area
Cell Biology
Target Synonyms
Acid phosphatase 1 soluble; Acid phosphatase of erythrocyte ; ACP1; Adipocyte acid phosphatase; Cytoplasmic phosphotyrosyl protein phosphatase; HAAP; LMW-PTP; LMW-PTPase; Low molecular weight cytosolic acid phosphatase; Low molecular weight phosphotyrosine protein phosphatase; PAP1; PAP2; phosphatase; acid; of erythrocyte; PPAC_HUMAN; Protein tyrosine phosphatase; PTPase; Purple acid phosphatase; Red cell acid phosphatase 1; testicular secretory protein Li 37
Target Background
The product of this gene belongs to the phosphotyrosine protein phosphatase family of proteins. It functions as an acid phosphatase and a protein tyrosine phosphatase by hydrolyzing protein tyrosine phosphate to protein tyrosine and orthophosphate. This enzyme also hydrolyzes orthophosphoric monoesters to alcohol and orthophosphate. This gene is genetically polymorphic, and three common alleles segregating at the corresponding locus give rise to six phenotypes. Each allele appears to encode at least two electrophoretically different isozymes, Bf and Bs, which are produced in allele-specific ratios. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene.
Notification