-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ACSL3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 600-700 of human ACSL3 (NP_004448.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against ACSL3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 600-700 of human ACSL3 (NP_004448.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-16685A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ACSL3 |
| Target Synonyms | ACS3; FACL3; LACS3; LACS 3; PRO2194; ACSL3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, K-562, Mouse spinal cord | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 600-700 of human ACSL3 (NP_004448.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ALKNLPLVDNICAYANSYHSYVIGFVVPNQKELTELARKKGLKGTWEELCNSCEMENEVLKVLSEAAISASLEKFEIPVKIRLSPEPWTPETGLVTDAFKL | Uniprot ID | O95573 |
Uniprot Id
O95573
Target Species
Human
Target Name
ACSL3
Target Full Name
Fatty acid CoA ligase Acsl3
Target Function
Acyl-CoA synthetases (ACSL) activates long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. Required for the incorporation of fatty acids into phosphatidylcholine, the major phospholipid located on the surface of VLDL (very low density lipoproteins). Has mainly an anabolic role in energy metabolism. Mediates hepatic lipogenesis. Preferentially uses myristate, laurate, arachidonate and eicosapentaenoate as substrates. Both isoforms exhibit the same level of activity.
Target Subcellular Location
Mitochondrion outer membrane; Single-pass type III membrane protein. Peroxisome membrane; Single-pass type III membrane protein. Microsome membrane; Single-pass type III membrane protein. Endoplasmic reticulum membrane; Single-pass type III membrane protein.
Target Protein Families
ATP-dependent AMP-binding enzyme family
Target Synonyms
ACSL3; ACS3; FACL3; LACS3; Fatty acid CoA ligase Acsl3; Arachidonate--CoA ligase; Long-chain acyl-CoA synthetase 3; LACS 3; Long-chain-fatty-acid--CoA ligase 3; Medium-chain acyl-CoA ligase Acsl3
Target Background
The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in brain, and preferentially utilizes myristate, arachidonate, and eicosapentaenoate as substrates. The amino acid sequence of this isozyme is 92% identical to that of rat homolog. Two transcript variants encoding the same protein have been found for this gene.
Notification