Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ACSM1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human ACSM1(NP_443188.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
The antibody against ACSM1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human ACSM1(NP_443188.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
Immunohistochemistry analysis of?ACSM1 in paraffin-embedded?human liver tissue using?ACSM1 Rabbit pAb at a dilution of 1:100 (40x lens).?High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
| Cat.No | ADA-08332A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ACSM1 |
| Target Synonyms | BUCS1; MACS1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human ACSM1(NP_443188.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ILYRLQLSKAKGIVTIDALASEVDSIASQCPSLKTKLLVSDHSREGWLDFRSLVKSASPEHTCVKSKTLDPMVIFFTSGTTGFPKMAKHSHGLALQPSFPG | Uniprot ID | Q08AH1 |
Uniprot Id
Q08AH1
Target Species
Human
Target Name
ACSM1
Target Full Name
Acyl-coenzyme A synthetase ACSM1, mitochondrial
Target Function
Catalyzes the activation of fatty acids by CoA to produce an acyl-CoA, the first step in fatty acid metabolism. Capable of activating medium-chain fatty acids (e.g. butyric (C4) to decanoic (C10) acids), and certain carboxylate-containing xenobiotics, e.g. benzoate. Also catalyzes the activation of lipoate to lipoyl-nucleoside monophosphate. Activates lipoate with GTP at a 1000-fold higher rate than with ATP and activates both (R)- and (S)-lipoate to the respective lipoyl-GMP, with a preference for (R)-lipoate.
Target Subcellular Location
Mitochondrion matrix. Mitochondrion.
Target Protein Families
ATP-dependent AMP-binding enzyme family
Target Synonyms
ACSM1; ACSM1_HUMAN; Acyl-CoA synthetase medium-chain family member 1; Acyl-coenzyme A synthetase ACSM1; BUCS1; Butyrate--CoA ligase 1; Butyryl-coenzyme A synthetase 1; LAE; Lipoate-activating enzyme; MACS1; Middle-chain acyl-CoA synthetase 1; mitochondrial
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
