Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ACTR10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 218-417 of human ACTR10 (NP_060947.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ACTR10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 218-417 of human ACTR10 (NP_060947.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04780A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ACTR10 |
| Target Synonyms | Arp10; Arp11; ACTR11; HARP11; ACTR10 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, 293T, Mouse lung, SKOV3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 218-417 of human ACTR10 (NP_060947.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SDLKRGLKIQAAKFNIDGNNERPSPPPNVDYPLDGEKILHILGSIRDSVVEILFEQDNEEQSVATLILDSLIQCPIDTRKQLAENLVVIGGTSMLPGFLHRLLAEIRYLVEKPKYKKALGTKTFRIHTPPAKANCVAWLGGAIFGALQDILGSRSVSKEYYNQTGRIPDWCSLNNPPLEMMFDVGKTQPPLMKRAFSTEK | Uniprot ID | Q9NZ32 |
Uniprot Id
Q9NZ32
Target Species
Human
Target Name
ACTR10
Target Full Name
Actin-related protein 10
Target Subcellular Location
Cytoplasm, cytoskeleton.
Target Protein Families
Actin family
Target Synonyms
ACTR10; ACTR11; ARP11; Actin-related protein 10; Actin-related protein 11; hARP11
Target Background
Predicted to be involved in retrograde axonal transport of mitochondrion. Predicted to be located in cytosol; extracellular region; and secretory granule. Predicted to be part of dynactin complex.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
