-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ACTR1B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 300-376 of human ACTR1B (NP_005726.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ELISA.
The antibody against ACTR1B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 300-376 of human ACTR1B (NP_005726.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ELISA.
| Cat.No | ADA-14576A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ACTR1B |
| Target Synonyms | PC3; ARP1B; CTRN2; ACTR1B | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, Hep G2, Jurkat, U-87MG | Application | ELISA, WB, IHC-P, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 300-376 of human ACTR1B (NP_005726.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LSGGSTLFKGFGDRLLSEVKKLAPKDIKIKISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGSRAIHRKTF | Uniprot ID | P42025 |
Uniprot Id
P42025
Target Species
Human
Target Name
ACTR1B
Target Full Name
Beta-centractin
Target Function
Component of a multi-subunit complex involved in microtubule based vesicle motility. It is associated with the centrosome.
Target Subcellular Location
Cytoplasm, cytoskeleton. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome.
Target Protein Families
Actin family, ARP1 subfamily
Target Synonyms
Actin related protein 1B; Actin-related protein 1B; ACTR 1B; ACTR1B; ACTY_HUMAN; ARP 1B; ARP1 actin related protein 1 homolog B; ARP1 actin related protein 1 homolog B centractin beta (yeast); ARP1 actin related protein 1 homolog B centractin beta; ARP1 actin related protein 1 yeast homolog B centractin beta; ARP1 yeast homolog B; ARP1B; Beta centractin; Beta-centractin; Centractin beta (Yeast); Centractin beta; CTRN 2; CTRN2; PC 3; PC3
Target Background
This gene encodes a 42.3 kD subunit of dynactin, a macromolecular complex consisting of 10 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein and is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit, like ACTR1A, is an actin-related protein. These two proteins, which are of equal length and share 90% amino acid identity, are present in a constant ratio of approximately 1:15 in the dynactin complex.
Notification