Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ADAMTS1 was raised in Rabbit using the recombinant fusion protein containing a sequen cecorresponding to amino acids 50-174 of human ADAMTS1(NP_008919.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
The antibody against ADAMTS1 was raised in Rabbit using the recombinant fusion protein containing a sequen cecorresponding to amino acids 50-174 of human ADAMTS1(NP_008919.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
Immunofluorescence analysis of 293F cells using ADAMTS1 Rabbit mAb at a dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
| Cat.No | ADA-15396A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ADAMTS1 |
| Target Synonyms | ADAMTS1; C3-C5; METH1; ADAM metallopeptidase with thrombospondin type 1 motif 1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequen cecorresponding to amino acids 50-174 of human ADAMTS1(NP_008919.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LGRPSEEDEELVVPELERAPGHGTTRLRLHAFDQQLDLELRPDSSFLAPGFTLQNVGRKSGSETPLPETDLAHCFYSGTVNGDPSSAAALSLCEGVRGAFYLLGEAYFIQPLPAASERLATAAPG | Uniprot ID | Q9UHI8 |
Uniprot Id
Q9UHI8
Target Species
Human
Target Name
ADAMTS1
Target Full Name
A disintegrin and metalloproteinase with thrombospondin motifs 1
Target Function
Cleaves aggrecan, a cartilage proteoglycan, at the '1938-Glu-|-Leu-1939' site (within the chondroitin sulfate attachment domain), and may be involved in its turnover. Has angiogenic inhibitor activity. Active metalloprotease, which may be associated with various inflammatory processes as well as development of cancer cachexia. May play a critical role in follicular rupture.
Target Subcellular Location
Secreted, extracellular space, extracellular matrix.
Target Synonyms
A disintegrin and metalloproteinase with thrombospondin motifs 1; ADAM-TS 1; ADAM-TS1; ADAMTS 1; ADAMTS; ADAMTS-1; Adamts1; ATS1_HUMAN; C3 C5; KIAA1346,; METH 1; METH-1
Target Background
This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motif) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The protein encoded by this gene contains two disintegrin loops and three C-terminal TS motifs and has anti-angiogenic activity. The expression of this gene may be associated with various inflammatory processes as well as development of cancer cachexia. This gene is likely to be necessary for normal growth, fertility, and organ morphology and function.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
