-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ADAMTS2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1029-1213 of human ADAMTS2 (O95450) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ADAMTS2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1029-1213 of human ADAMTS2 (O95450) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11717A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ADAMTS2 |
| Target Synonyms | NPI; PNPI; PCINP; PCPNI; PCI-NP; PC I-NP; ADAM-TS2; ADAMTS-2; ADAMTS-3; EDSDERMS; ADAMTS2 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A375, Rat thymus, THP-1, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1029-1213 of human ADAMTS2 (O95450). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PRNISDPSKKSYVVQWLSRPDPDSPIRKISSKGHCQGDKSIFCRMEVLSRYCSIPGYNKLCCKSCNLYNNLTNVEGRIEPPPGKHNDIDVFMPTLPVPTVAMEVRPSPSTPLEVPLNASSTNATEDHPETNAVDEPYKIHGLEDEVQPPNLIPRRPSPYEKTRNQRIQELIDEMRKKEMLGKF | Uniprot ID | O95450 |
Uniprot Id
O95450
Target Species
Human
Target Name
ADAMTS2
Target Full Name
A disintegrin and metalloproteinase with thrombospondin motifs 2
Target Function
Cleaves the propeptides of type I and II collagen prior to fibril assembly. Does not act on type III collagen. Cleaves lysyl oxidase LOX at a site downstream of its propeptide cleavage site to produce a short LOX form with reduced collagen-binding activity.
Target Involvement
Ehlers-Danlos syndrome 7C (EDS7C)
Target Subcellular Location
Secreted, extracellular space, extracellular matrix.
Target Tissue Specificity
Expressed at high level in skin, bone, tendon and aorta and at low levels in thymus and brain.
Target Research Area
Cancer
Target Synonyms
A disintegrin and metalloproteinase with thrombospondin motifs 2; A disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif 2; ADAM metallopeptidase with thrombospondin type 1 motif 2; ADAM TS 2; ADAM TS2; ADAM-TS 2; ADAM-TS2; ADAMTS 3; ADAMTS-2; ADAMTS2; ATS2_HUMAN; EC 3.4.24.14; EDS VIIB; EDS VIIC; hPCPNI ; NPI ; PC I NP; PC I-NP; PCINP ; PCPNI ; pNPI; Procollagen I N proteinase; Procollagen I N-proteinase; Procollagen I/II amino propeptide processing enzyme; Procollagen I/II amino propeptide-processing enzyme; Procollagen N endopeptidase ; Procollagen N-endopeptidase
Target Background
This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The encoded preproprotein is proteolytically processed to generate the mature procollagen N-proteinase. This proteinase excises the N-propeptide of the fibrillar procollagens types I-III and type V. Mutations in this gene cause Ehlers-Danlos syndrome type VIIC, a recessively inherited connective-tissue disorder. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed.
Notification