-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ADCYAP1R1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-140 of human ADCYAP1R1 (NP_001109.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against ADCYAP1R1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-140 of human ADCYAP1R1 (NP_001109.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-11853A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ADCYAP1R1 |
| Target Synonyms | PAC1; PAC1R; PACAPR; PACAPRI; ADCYAP1R1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, U-87MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 25-140 of human ADCYAP1R1 (NP_001109.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | CIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLVSCPELFRIFNPDQVWETETIGESDFGDSNSLDLSDMGVVSRNCTEDGWSEPFPHYFDACGFDEYE | Uniprot ID | P41586 |
Uniprot Id
P41586
Target Species
Human
Target Name
ADCYAP1R1
Target Full Name
Pituitary adenylate cyclase-activating polypeptide type I receptor
Target Function
This is a receptor for PACAP-27 and PACAP-38. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. May regulate the release of adrenocorticotropin, luteinizing hormone, growth hormone, prolactin, epinephrine, and catecholamine. May play a role in spermatogenesis and sperm motility. Causes smooth muscle relaxation and secretion in the gastrointestinal tract.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 2 family
Target Tissue Specificity
Most abundant in the brain, low expression in the lung, liver, thymus, spleen, pancreas and placenta.
Target Synonyms
ADCYAP1R1; Pituitary adenylate cyclase-activating polypeptide type I receptor; PACAP type I receptor; PACAP-R-1; PACAP-R1
Target Background
This gene encodes type I adenylate cyclase activating polypeptide receptor, which is a membrane-associated protein and shares significant homology with members of the glucagon/secretin receptor family. This receptor mediates diverse biological actions of adenylate cyclase activating polypeptide 1 and is positively coupled to adenylate cyclase. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified.
Notification