Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Adenylate kinase 4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Adenylate kinase 4 (P27144) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against Adenylate kinase 4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Adenylate kinase 4 (P27144) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-14409A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Adenylate kinase 4 |
| Target Synonyms | AK3; AK 4; AK3L1; AK3L2; Adenylate kinase 4 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, SH-SY5Y | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Adenylate kinase 4 (P27144). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MASKLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEAL | Uniprot ID | P27144 |
Uniprot Id
P27144
Target Species
Human
Target Name
AK4
Target Full Name
Adenylate kinase 4, mitochondrial
Target Function
Involved in maintaining the homeostasis of cellular nucleotides by catalyzing the interconversion of nucleoside phosphates. Efficiently phosphorylates AMP and dAMP using ATP as phosphate donor, but phosphorylates only AMP when using GTP as phosphate donor. Also displays broad nucleoside diphosphate kinase activity. Plays a role in controlling cellular ATP levels by regulating phosphorylation and activation of the energy sensor protein kinase AMPK. Plays a protective role in the cellular response to oxidative stress.
Target Subcellular Location
Mitochondrion matrix.
Target Protein Families
Adenylate kinase family, AK3 subfamily
Target Tissue Specificity
Highly expressed in kidney, moderately expressed in heart and liver and weakly expressed in brain.
Target Research Area
Metabolism
Target Synonyms
Adenylate kinase 3 like 1; Adenylate kinase 3-like; adenylate kinase 4; Adenylate kinase isoenzyme 4; mitochondrial; AK3; AK3L1; AK3L2; AK4; ATP AMP transphosphorylase; ATP-AMP transphosphorylase; GTP:AMP phosphotransferase ; KAD4_HUMAN; MGC166959; mitochondrial adenylate kinase 3; nucleoside-triphosphate adenylate kinase
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
