Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ADGRD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 805-874 of human ADGRD1 (NP_942122.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ADGRD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 805-874 of human ADGRD1 (NP_942122.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06297A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ADGRD1 |
| Target Synonyms | PGR25; GPR133; ADGRD1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, 293T, LO2, Mouse liver, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 805-874 of human ADGRD1 (NP_942122.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FHCLLNSEVRAAFKHKTKVWSLTSSSARTSNAKPFHSDLMNGTRPGMASTKLSPWDKSSHSAHRVDLSAV | Uniprot ID | Q6QNK2 |
Uniprot Id
Q6QNK2
Target Species
Human
Target Name
ADGRD1
Target Full Name
Adhesion G-protein coupled receptor D1
Target Function
Orphan receptor. Signals via G(s)-alpha family of G-proteins. Has protumorigenic function especially in glioblastoma.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 2 family, Adhesion G-protein coupled receptor (ADGR) subfamily
Target Tissue Specificity
Up-regulated in CD133(+) cell population of glioblastoma.
Target Synonyms
DKFZp434B1272; FLJ16770; G protein coupled receptor 133; G protein coupled receptor PGR25; G-protein coupled receptor PGR25; GP133_HUMAN; Gpr133; MGC138512; MGC138514; PGR25; Probable G-protein coupled receptor 133
Target Background
The adhesion G-protein-coupled receptors (GPCRs), including GPR133, are membrane-bound proteins with long N termini containing multiple domains. GPCRs, or GPRs, contain 7 transmembrane domains and transduce extracellular signals through heterotrimeric G proteins (summary by Bjarnadottir et al., 2004 [PubMed 15203201]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
