-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ADIPOR1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-136 of human Adiponectin Receptor 1 (NP_057083.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ADIPOR1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-136 of human Adiponectin Receptor 1 (NP_057083.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08729A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ADIPOR1 |
| Target Synonyms | CGI45; PAQR1; ACDCR1; CGI-45; TESBP1A; ADIPOR1 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse skeletal muscle, Rat skeletal muscle | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-136 of human Adiponectin Receptor 1 (NP_057083.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEEEEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETG | Uniprot ID | Q96A54 |
Uniprot Id
Q96A54
Target Species
Human
Target Name
ADIPOR1
Target Full Name
Adiponectin receptor protein 1
Target Function
Receptor for ADIPOQ, an essential hormone secreted by adipocytes that regulates glucose and lipid metabolism. Required for normal glucose and fat homeostasis and for maintaining a normal body weight. ADIPOQ-binding activates a signaling cascade that leads to increased AMPK activity, and ultimately to increased fatty acid oxidation, increased glucose uptake and decreased gluconeogenesis. Has high affinity for globular adiponectin and low affinity for full-length adiponectin.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
ADIPOR family
Target Tissue Specificity
Widely expressed. Highly expressed in heart and skeletal muscle. Expressed at intermediate level in brain, spleen, kidney, liver, placenta, lung and peripheral blood leukocytes. Weakly expressed in colon, thymus and small intestine.
Target Research Area
Cardiovascular
Target Synonyms
ADIPOR1; PAQR1; TESBP1A; CGI-45; Adiponectin receptor protein 1; Progestin and adipoQ receptor family member 1; Progestin and adipoQ receptor family member I
Target Background
This gene encodes a protein which acts as a receptor for adiponectin, a hormone secreted by adipocytes which regulates fatty acid catabolism and glucose levels. Binding of adiponectin to the encoded protein results in activation of an AMP-activated kinase signaling pathway which affects levels of fatty acid oxidation and insulin sensitivity. A pseudogene of this gene is located on chromosome 14. Multiple alternatively spliced transcript variants have been found for this gene.
Notification