Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ADIPOR2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human ADIPOR2 (NP_078827.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ADIPOR2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human ADIPOR2 (NP_078827.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-12321A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ADIPOR2 |
| Target Synonyms | PAQR2; ACDCR2; ADIPOR2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat skeletal muscle | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human ADIPOR2 (NP_078827.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MNEPTENRLGCSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSEEHEYSDEAPQEDEGFMGMSPLLQAHHAMEKMEEFVCKVWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETG | Uniprot ID | Q86V24 |
Uniprot Id
Q86V24
Target Species
Human
Target Name
ADIPOR2
Target Full Name
Adiponectin receptor protein 2
Target Function
Receptor for ADIPOQ, an essential hormone secreted by adipocytes that regulates glucose and lipid metabolism. Required for normal body fat and glucose homeostasis. ADIPOQ-binding activates a signaling cascade that leads to increased PPARA activity, and ultimately to increased fatty acid oxidation and glucose uptake. Has intermediate affinity for globular and full-length adiponectin. Required for normal revascularization after chronic ischemia caused by severing of blood vessels.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
ADIPOR family
Target Tissue Specificity
Ubiquitous. Highly expressed in skeletal muscle, liver and placenta. Weakly expressed in brain, heart, colon, spleen, kidney, thymus, small intestine, peripheral blood leukocytes and lung.
Target Synonyms
ADIPOR2; PAQR2; Adiponectin receptor protein 2; Progestin and adipoQ receptor family member 2; Progestin and adipoQ receptor family member II
Target Background
The adiponectin receptors, ADIPOR1 (MIM 607945) and ADIPOR2, serve as receptors for globular and full-length adiponectin (MIM 605441) and mediate increased AMPK (see MIM 602739) and PPAR-alpha (PPARA; MIM 170998) ligand activities, as well as fatty acid oxidation and glucose uptake by adiponectin (Yamauchi et al., 2003 [PubMed 12802337]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
