-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against AEBP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 999-1158 of human AEBP1 (NP_001120.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against AEBP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 999-1158 of human AEBP1 (NP_001120.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-11662A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | AEBP1 |
| Target Synonyms | ACLP; AEBP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 999-1158 of human AEBP1 (NP_001120.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NRPIPHIDPSRPMTPQQRRLQQRRLQHRLRLRAQMRLRRLNATTTLGPHTVPPTLPPAPATTLSTTIEPWGLIPPTTAGWEESETETYTEVVTEFGTEVEPEFGTKVEPEFETQLEPEFETQLEPEFEEEEEEEKEEEIATGQAFPFTTVETYTVNFGDF | Uniprot ID | Q8IUX7 |
Uniprot Id
Q8IUX7
Target Species
Human
Target Name
AEBP1
Target Full Name
Adipocyte enhancer-binding protein 1
Target Function
As a positive regulator of collagen fibrillogenesis, it is probably involved in the organization and remodeling of the extracellular matrix.; May positively regulate MAP-kinase activity in adipocytes, leading to enhanced adipocyte proliferation and reduced adipocyte differentiation. May also positively regulate NF-kappa-B activity in macrophages by promoting the phosphorylation and subsequent degradation of I-kappa-B-alpha (NFKBIA), leading to enhanced macrophage inflammatory responsiveness. Can act as a transcriptional repressor.
Target Subcellular Location
[Isoform 1]: Secreted.; [Isoform 2]: Cytoplasm. Nucleus.
Target Protein Families
Peptidase M14 family
Target Tissue Specificity
Expressed in osteoblast and visceral fat.
Target Synonyms
AEBP1; ACLP; Adipocyte enhancer-binding protein 1; AE-binding protein 1; Aortic carboxypeptidase-like protein
Target Background
This gene encodes a member of carboxypeptidase A protein family. The encoded protein may function as a transcriptional repressor and play a role in adipogenesis and smooth muscle cell differentiation. Studies in mice suggest that this gene functions in wound healing and abdominal wall development. Overexpression of this gene is associated with glioblastoma.
Notification