Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against AER61 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human AER61 (NP_775925.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against AER61 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human AER61 (NP_775925.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14570A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | AER61 |
| Target Synonyms | AOS4; AER61; EOGT1; C3orf64 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, HepG2, Mouse lung, Rat lung, Rat uterus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human AER61 (NP_775925.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MLMLFVFGVLLHEVSLSGQNEAPPNTHSIPGEPLYNYASIRLPEEHIPFFLHNNRHIATVCRKDSLCPYKKHLEKLKYCWGYEKSCKPEFRFGYPVCSYVDMGWTDTLESAEDIFWKQADFGYARERLEEMHVLCQPKETSDSSLVCSRY | Uniprot ID | Q5NDL2 |
Uniprot Id
Q5NDL2
Target Species
Human
Target Name
EOGT
Target Full Name
EGF domain-specific O-linked N-acetylglucosamine transferase
Target Function
Catalyzes the transfer of a single N-acetylglucosamine from UDP-GlcNAc to a serine or threonine residue in extracellular proteins resulting in their modification with a beta-linked N-acetylglucosamine (O-GlcNAc). Specifically glycosylates the Thr residue located between the fifth and sixth conserved cysteines of folded EGF-like domains.
Target Involvement
Adams-Oliver syndrome 4 (AOS4)
Target Subcellular Location
Endoplasmic reticulum lumen.
Target Protein Families
Glycosyltransferase 61 family
Target Synonyms
EOGT; AER61; C3orf64; EOGT1EGF domain-specific O-linked N-acetylglucosamine transferase; EC 2.4.1.255; Extracellular O-linked N-acetylglucosamine transferase
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
