-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Aggrecan was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 420-575 of human Aggrecan (NP_037359.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
The antibody against Aggrecan was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 420-575 of human Aggrecan (NP_037359.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
| Cat.No | ADA-12993A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Aggrecan |
| Target Synonyms | AGC1; SEDK; AGCAN; CSPG1; MSK16; CSPGCP; SSOAOD; Aggrecan | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 420-575 of human Aggrecan (NP_037359.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FAPEIGATAFAEVENETGEATRPWGFPTPGLGPATAFTSEDLVVQVTAVPGQPHLPGGVVFHYRPGPTRYSLTFEEAQQACLRTGAVIASPEQLQAAYEAGYEQCDAGWLRDQTVRYPIVSPRTPCVGDKDSSPGVRTYGVRPSTETYDVYCFVDR | Uniprot ID | P16112 |
Uniprot Id
P16112
Target Species
Human
Target Name
ACAN
Target Full Name
Aggrecan core protein
Target Function
This proteoglycan is a major component of extracellular matrix of cartilagenous tissues. A major function of this protein is to resist compression in cartilage. It binds avidly to hyaluronic acid via an N-terminal globular region.
Target Involvement
Spondyloepiphyseal dysplasia type Kimberley (SEDK); Spondyloepimetaphyseal dysplasia, aggrecan type (SEMDAG); Short stature and advanced bone age, with or without early-onset osteoarthritis and/or osteochondritis dissecans (SSOAOD)
Target Subcellular Location
Secreted, extracellular space, extracellular matrix.
Target Protein Families
Aggrecan/versican proteoglycan family
Target Tissue Specificity
Restricted to cartilages.
Target Synonyms
ACAN; AGC1; CSPG1; MSK16; Aggrecan core protein; Cartilage-specific proteoglycan core protein; CSPCP; Chondroitin sulfate proteoglycan core protein 1; Chondroitin sulfate proteoglycan 1) [Cleaved into: Aggrecan core protein 2]
Target Background
This gene is a member of the aggrecan/versican proteoglycan family. The encoded protein is an integral part of the extracellular matrix in cartilagenous tissue and it withstands compression in cartilage. Mutations in this gene may be involved in skeletal dysplasia and spinal degeneration. Multiple alternatively spliced transcript variants that encode different protein isoforms have been observed in this gene.
Notification