-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against AGK was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 233-422 of human AGK (NP_060708.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against AGK was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 233-422 of human AGK (NP_060708.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10855A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | AGK |
| Target Synonyms | MULK; CATC5; CTRCT38; MTDPS10; AGK | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | SK-MEL-28 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 233-422 of human AGK (NP_060708.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KAAHFFSTLKEWPQTHQASISYTGPTERPPNEPEETPVQRPSLYRRILRRLASYWAQPQDALSQEVSPEVWKDVQLSTIELSITTRNNQLDPTSKEDFLNICIEPDTISKGDFITIGSRKVRNPKLHVEGTECLQASQCTLLIPEGAGGSFSIDSEEYEAMPVEVKLLPRKLQFFCDPRKREQMLTSPTQ | Uniprot ID | Q53H12 |
Uniprot Id
Q53H12
Target Species
Human
Target Name
AGK
Target Full Name
Acylglycerol kinase, mitochondrial
Target Function
Lipid kinase that can phosphorylate both monoacylglycerol and diacylglycerol to form lysophosphatidic acid (LPA) and phosphatidic acid (PA), respectively. Does not phosphorylate sphingosine. Phosphorylates ceramide. Phosphorylates 1,2-dioleoylglycerol more rapidly than 2,3-dioleoylglycerol. Independently of its lipid kinase activity, acts as a component of the TIM22 complex. The TIM22 complex mediates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane by forming a twin-pore translocase that uses the membrane potential as the external driving force. In the TIM22 complex, required for the import of a subset of metabolite carriers into mitochondria, such as ANT1/SLC25A4 and SLC25A24, while it is not required for the import of TIMM23. Overexpression increases the formation and secretion of LPA, resulting in transactivation of EGFR and activation of the downstream MAPK signaling pathway, leading to increased cell growth.
Target Involvement
Mitochondrial DNA depletion syndrome 10 (MTDPS10); Cataract 38 (CTRCT38)
Target Subcellular Location
Mitochondrion inner membrane; Peripheral membrane protein. Mitochondrion intermembrane space.
Target Protein Families
AGK family
Target Tissue Specificity
Highly expressed in muscle, heart, kidney and brain.
Target Synonyms
2610037M15Rik; 6720408I04Rik; Acylglycerol Kinase; Acylglycerol kinase mitochondrial; Acylglycerol kinase; mitochondrial; agk; AGK_HUMAN; AI465370; FLJ10842; hAGK; HsMuLK; MuLK; Multi substrate lipid kinase; Multi-substrate lipid kinase; Multiple substrate lipid kinase; RGD1562046
Target Background
The protein encoded by this gene is a mitochondrial membrane protein involved in lipid and glycerolipid metabolism. The encoded protein is a lipid kinase that catalyzes the formation of phosphatidic and lysophosphatidic acids. Defects in this gene have been associated with mitochondrial DNA depletion syndrome 10.
Notification