-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against AGRP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 21-132 of human AGRP (NP_001129.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against AGRP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 21-132 of human AGRP (NP_001129.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-01812A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | AGRP |
| Target Synonyms | ART; AGRT; ASIP2; AGRP | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse skeletal muscle | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 21-132 of human AGRP (NP_001129.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AQMGLAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAEEDLLQEAQALAEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT | Uniprot ID | O00253 |
Uniprot Id
O00253
Target Species
Human
Target Name
AGRP
Target Full Name
Agouti-related protein
Target Function
Plays a role in weight homeostasis. Involved in the control of feeding behavior through the central melanocortin system. Acts as alpha melanocyte-stimulating hormone antagonist by inhibiting cAMP production mediated by stimulation of melanocortin receptors within the hypothalamus and adrenal gland. Has very low activity with MC5R. Is an inverse agonist for MC3R and MC4R being able to suppress their constitutive activity. It promotes MC3R and MC4R endocytosis in an arrestin-dependent manner.
Target Involvement
Obesity (OBESITY)
Target Subcellular Location
Secreted. Golgi apparatus lumen.
Target Tissue Specificity
Expressed primarily in the adrenal gland, subthalamic nucleus, and hypothalamus, with a lower level of expression occurring in testis, lung, and kidney.
Target Research Area
Cardiovascular
Target Synonyms
Agouti related neuropeptide; Agouti Related Protein Homolog; Agouti-related protein; Agrp; AGRP_HUMAN; AGRT; ART; ASIP2
Target Background
This gene encodes an antagonist of the melanocortin-3 and melanocortin-4 receptor. It appears to regulate hypothalamic control of feeding behavior via melanocortin receptor and/or intracellular calcium regulation, and thus plays a role in weight homeostasis. Mutations in this gene have been associated with late on-set obesity.
Notification