-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against AK2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human AK2 (P54819) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against AK2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human AK2 (P54819) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-14503A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | AK2 |
| Target Synonyms | ADK2; K2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, Hep G2, Mouse liver, Rat kidney, Rat liver | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human AK2 (P54819). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEY | Uniprot ID | P54819 |
Uniprot Id
P54819
Target Species
Human
Target Name
AK2
Target Full Name
Adenylate kinase 2, mitochondrial
Target Function
Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolism. Adenylate kinase activity is critical for regulation of the phosphate utilization and the AMP de novo biosynthesis pathways. Plays a key role in hematopoiesis.
Target Involvement
Reticular dysgenesis (RDYS)
Target Subcellular Location
Mitochondrion intermembrane space.
Target Protein Families
Adenylate kinase family, AK2 subfamily
Target Tissue Specificity
Present in most tissues. Present at high level in heart, liver and kidney, and at low level in brain, skeletal muscle and skin. Present in thrombocytes but not in erythrocytes, which lack mitochondria. Present in all nucleated cell populations from blood,
Target Research Area
Cell Biology
Target Synonyms
Adenylate kinase 2; adenylate kinase 2, mitochondrial; Adenylate kinase isoenzyme 2; ADK2; AK 2; ak2; ATP AMP transphosphorylase ; ATP-AMP transphosphorylase 2; EC 2.7.4.3; KAD2_HUMAN; mitochondrial
Target Background
Adenylate kinases are involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. Three isozymes of adenylate kinase, namely 1, 2, and 3, have been identified in vertebrates; this gene encodes isozyme 2. Expression of these isozymes is tissue-specific and developmentally regulated. Isozyme 2 is localized in the mitochondrial intermembrane space and may play a role in apoptosis. Mutations in this gene are the cause of reticular dysgenesis. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 1 and 2.
Notification