-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against AKAP8 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 592-692 of human AKAP8 (NP_005849.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against AKAP8 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 592-692 of human AKAP8 (NP_005849.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-02765A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | AKAP8 |
| Target Synonyms | AKAP-8; AKAP95; AKAP 95; AKAP-95; AKAP8 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, BT-474, HL-60, SKOV3 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 592-692 of human AKAP8 (NP_005849.1) | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EGAPAPESSGEPAEDEGPTDTAEAGSDPQAEQLLEEQVPCGTAHEKGVPKARSEAAEAGNGAETMAAEAESAQTRVAPAPAAADAEVEQTDAESKDAVPTE | Uniprot ID | O43823 |
Uniprot Id
O43823
Target Species
Human
Target Name
AKAP8
Target Full Name
A-kinase anchor protein 8
Target Function
Anchoring protein that mediates the subcellular compartmentation of cAMP-dependent protein kinase (PKA type II). Acts as an anchor for a PKA-signaling complex onto mitotic chromosomes, which is required for maintenance of chromosomes in a condensed form throughout mitosis. Recruits condensin complex subunit NCAPD2 to chromosomes required for chromatin condensation; the function appears to be independent from PKA-anchoring. May help to deliver cyclin D/E to CDK4 to facilitate cell cycle progression. Required for cell cycle G2/M transition and histone deacetylation during mitosis. In mitotic cells recruits HDAC3 to the vicinity of chromatin leading to deacetylation and subsequent phosphorylation at 'Ser-10' of histone H3; in this function may act redundantly with AKAP8L. Involved in nuclear retention of RPS6KA1 upon ERK activation thus inducing cell proliferation. May be involved in regulation of DNA replication by acting as scaffold for MCM2. Enhances HMT activity of the KMT2 family MLL4/WBP7 complex and is involved in transcriptional regulation. In a teratocarcinoma cell line is involved in retinoic acid-mediated induction of developmental genes implicating H3 'Lys-4' methylation. May be involved in recruitment of active CASP3 to the nucleus in apoptotic cells. May act as a carrier protein of GJA1 for its transport to the nucleus. May play a repressive role in the regulation of rDNA transcription. Preferentially binds GC-rich DNA in vitro. In cells, associates with ribosomal RNA (rRNA) chromatin, preferentially with rRNA promoter and transcribed regions. Involved in modulation of Toll-like receptor signaling. Required for the cAMP-dependent suppression of TNF-alpha in early stages of LPS-induced macrophage activation; the function probably implicates targeting of PKA to NFKB1.
Target Subcellular Location
Nucleus. Nucleus matrix. Nucleus, nucleolus. Cytoplasm.
Target Protein Families
AKAP95 family
Target Tissue Specificity
Highly expressed in heart, liver, skeletal muscle, kidney and pancreas. Expressed in mature dendritic cells.
Target Research Area
Cell Biology
Target Synonyms
A kinase (PRKA) anchor protein 8; A kinase anchor protein 8; A kinase anchor protein 95; A kinase anchor protein 95 kDa; A kinase anchor protein 95kDa; A-kinase anchor protein 8; A-kinase anchor protein 95 kDa; AKAP 8; AKAP 95; AKAP-8; AKAP-95; Akap8; AKAP8_HUMAN; AKAP95; DKFZp586B1222
Target Background
This gene encodes a member of the A-kinase anchor protein family. A-kinase anchor proteins are scaffold proteins that contain a binding domain for the RI/RII subunit of protein kinase A (PKA) and recruit PKA and other signaling molecules to specific subcellular locations. This gene encodes a nuclear A-kinase anchor protein that binds to the RII alpha subunit of PKA and may play a role in chromosome condensation during mitosis by targeting PKA and the condensin complex to chromatin. A pseudogene of this gene is located on the short arm of chromosome 9.
Notification