-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against AKR1B1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human AKR1B1 (NP_001619.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against AKR1B1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human AKR1B1 (NP_001619.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-14781A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | AKR1B1 |
| Target Synonyms | AR; ADR; ALR2; ALDR1; AKR1B1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, NIH/3T3, Rat heart, A549, Mouse skeletal muscle, Rat skeletal muscle | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human AKR1B1 (NP_001619.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVD | Uniprot ID | P15121 |
Uniprot Id
P15121
Target Species
Human
Target Name
AKR1B1
Target Full Name
Aldo-keto reductase family 1 member B1
Target Function
Catalyzes the NADPH-dependent reduction of a wide variety of carbonyl-containing compounds to their corresponding alcohols. Displays enzymatic activity towards endogenous metabolites such as aromatic and aliphatic aldehydes, ketones, monosacharides, bile acids and xenobiotics substrates. Key enzyme in the polyol pathway, catalyzes reduction of glucose to sorbitol during hyperglycemia. Reduces steroids and their derivatives and prostaglandins. Displays low enzymatic activity toward all-trans-retinal, 9-cis-retinal, and 13-cis-retinal. Catalyzes the reduction of diverse phospholipid aldehydes such as 1-palmitoyl-2-(5-oxovaleroyl)-sn -glycero-3-phosphoethanolamin (POVPC) and related phospholipid aldehydes that are generated from the oxydation of phosphotidylcholine and phosphatdyleethanolamides. Plays a role in detoxifying dietary and lipid-derived unsaturated carbonyls, such as crotonaldehyde, 4-hydroxynonenal, trans-2-hexenal, trans-2,4-hexadienal and their glutathione-conjugates carbonyls (GS-carbonyls).
Target Subcellular Location
Cytoplasm.
Target Protein Families
Aldo/keto reductase family
Target Tissue Specificity
Highly expressed in embryonic epithelial cells (EUE) in response to osmotic stress.
Target Synonyms
ADR; AKR1B 1; Akr1b1; Aldehyde reductase 1; Aldehyde reductase; Aldo keto reductase family 1; member B1; Aldo-keto reductase family 1 member B1; aldo-keto reductase family 1; member B1 (aldose reductase); Aldose reductase; aldr 1; ALDR_HUMAN; aldr1; ALR2; AR; Lii5 2 CTCL tumor antigen; Low Km aldose reductase; MGC1804
Target Background
This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member catalyzes the reduction of a number of aldehydes, including the aldehyde form of glucose, and is thereby implicated in the development of diabetic complications by catalyzing the reduction of glucose to sorbitol. Multiple pseudogenes have been identified for this gene. The nomenclature system used by the HUGO Gene Nomenclature Committee to define human aldo-keto reductase family members is known to differ from that used by the Mouse Genome Informatics database.
Notification