-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against AKT1S1/PRAS40 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-256 of human AKT1S1/PRAS40 (NP_001092103.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against AKT1S1/PRAS40 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-256 of human AKT1S1/PRAS40 (NP_001092103.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07821A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | AKT1S1/PRAS40 |
| Target Synonyms | Lobe; PRAS40; AKT1S1/PRAS40 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | PC-3 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 150-256 of human AKT1S1/PRAS40 (NP_001092103.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | STDDGSLSEETPAGPPTCSVPPASALPTQQYAKSLPVSVPVWGFKEKRTEARSSDEENGPPSSPDLDRIAASMRALVLREAEDTQVFGDLPRPRLNTSDFQKLKRKY | Uniprot ID | Q96B36 |
Uniprot Id
Q96B36
Target Species
Human
Target Name
AKT1S1
Target Full Name
Proline-rich AKT1 substrate 1
Target Function
Subunit of mTORC1, which regulates cell growth and survival in response to nutrient and hormonal signals. mTORC1 is activated in response to growth factors or amino acids. Growth factor-stimulated mTORC1 activation involves a AKT1-mediated phosphorylation of TSC1-TSC2, which leads to the activation of the RHEB GTPase that potently activates the protein kinase activity of mTORC1. Amino acid-signaling to mTORC1 requires its relocalization to the lysosomes mediated by the Ragulator complex and the Rag GTPases. Activated mTORC1 up-regulates protein synthesis by phosphorylating key regulators of mRNA translation and ribosome synthesis. mTORC1 phosphorylates EIF4EBP1 and releases it from inhibiting the elongation initiation factor 4E (eiF4E). mTORC1 phosphorylates and activates S6K1 at 'Thr-389', which then promotes protein synthesis by phosphorylating PDCD4 and targeting it for degradation. Within mTORC1, AKT1S1 negatively regulates mTOR activity in a manner that is dependent on its phosphorylation state and binding to 14-3-3 proteins. Inhibits RHEB-GTP-dependent mTORC1 activation. Substrate for AKT1 phosphorylation, but can also be activated by AKT1-independent mechanisms. May also play a role in nerve growth factor-mediated neuroprotection.
Target Subcellular Location
Cytoplasm, cytosol.
Target Tissue Specificity
Widely expressed with highest levels of expression in liver and heart. Expressed at higher levels in cancer cell lines (e.g. A-549 and HeLa) than in normal cell lines (e.g. HEK293).
Target Synonyms
40 kDa proline rich AKT substrate ; 40 kDa proline-rich AKT substrate; AKT1 S1; AKT1 substrate 1 (proline rich) ; AKT1 substrate 1; AKT1S 1; AKT1S1; AKTS1_HUMAN; Lobe; MGC2865; PRAS 40; PRAS; PRAS40; Proline rich akt substrate ; Proline rich Akt substrate 40 kDa; Proline-rich AKT1 substrate 1
Target Background
AKT1S1 is a proline-rich substrate of AKT (MIM 164730) that binds 14-3-3 protein (see YWHAH, MIM 113508) when phosphorylated (Kovacina et al., 2003 [PubMed 12524439]).
Notification