-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ALAS1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 541-640 of human ALAS1 (P13196) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ALAS1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 541-640 of human ALAS1 (P13196) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13910A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ALAS1 |
| Target Synonyms | ALAS; MIG4; ALAS3; ALASH; ALAS-H; ALAS1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, HT-29, SKOV3 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 541-640 of human ALAS1 (P13196). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TEVCDELMSRHNIYVQAINYPTVPRGEELLRIAPTPHHTPQMMNYFLENLLVTWKQVGLELKPHSSAECNFCRRPLHFEVMSEREKSYFSGLSKLVSAQA | Uniprot ID | P13196 |
Uniprot Id
P13196
Target Species
Human
Target Name
ALAS1
Target Full Name
5-aminolevulinate synthase, non-specific, mitochondrial
Target Subcellular Location
Mitochondrion matrix.
Target Protein Families
Class-II pyridoxal-phosphate-dependent aminotransferase family
Target Synonyms
5 aminolevulinate synthase ; 5 aminolevulinate synthase nonspecific mitochondrial; 5 aminolevulinic acid synthase; 5-aminolevulinate synthase; 5-aminolevulinic acid synthase 1; Alas 1; ALAS 3; ALAS; ALAS H; ALAS HOUSEKEEPING TYPE; ALAS N; ALAS-H; alaS1; ALAS3; ALASH; Aminolevulinate delta synthase 1; Aminolevulinic acid synthase 1 ; Delta ALA synthetase; Delta aminolevulinate synthase; Delta-ALA synthase 1; Delta-aminolevulinate synthase 1; HEM1_HUMAN; MIG 4; MIG4; Migration inducing protein 4; mitochondrial; nonspecific
Target Background
This gene encodes the mitochondrial enzyme which is catalyzes the rate-limiting step in heme (iron-protoporphyrin) biosynthesis. The enzyme encoded by this gene is the housekeeping enzyme; a separate gene encodes a form of the enzyme that is specific for erythroid tissue. The level of the mature encoded protein is regulated by heme: high levels of heme down-regulate the mature enzyme in mitochondria while low heme levels up-regulate. A pseudogene of this gene is located on chromosome 12. Alternative splicing results in multiple transcript variants encoding different isoforms.
Notification