Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Alcohol Dehydrogenase was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 220-300 of human Alcohol Dehydrogenase (NP_000658.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Alcohol Dehydrogenase was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 220-300 of human Alcohol Dehydrogenase (NP_000658.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05501A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Alcohol Dehydrogenase |
| Target Synonyms | ADH1A; ADH1; Alcohol Dehydrogenase | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | LO2, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 220-300 of human Alcohol Dehydrogenase (NP_000658.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IIAVDINKDKFAKAKELGATECINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGVPPDSQ | Uniprot ID | P07327 |
Uniprot Id
P07327
Target Species
Human
Target Name
ADH1A
Target Full Name
Alcohol dehydrogenase 1A
Target Subcellular Location
Cytoplasm.
Target Protein Families
Zinc-containing alcohol dehydrogenase family
Target Synonyms
ADH alpha subunit; ADH; ADH1; ADH1A; ADH1A_HUMAN; Alcohol dehydrogenase 1 (class I), alpha polypeptide; Alcohol dehydrogenase 1; Alcohol dehydrogenase 1A (class I), alpha polypeptide; Alcohol dehydrogenase 1A; Alcohol dehydrogenase subunit alpha; Aldehyde reductase
Target Background
This gene encodes a member of the alcohol dehydrogenase family. The encoded protein is the alpha subunit of class I alcohol dehydrogenase, which consists of several homo- and heterodimers of alpha, beta and gamma subunits. Alcohol dehydrogenases catalyze the oxidation of alcohols to aldehydes. This gene is active in the liver in early fetal life but only weakly active in adult liver. This gene is found in a cluster with six additional alcohol dehydrogenase genes, including those encoding the beta and gamma subunits, on the long arm of chromosome 4. Mutations in this gene may contribute to variation in certain personality traits and substance dependence.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
