Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ALDH1A2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human ALDH1A2 (NP_733797.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against ALDH1A2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human ALDH1A2 (NP_733797.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-11028A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ALDH1A2 |
| Target Synonyms | DIH4; RALDH2; RALDH2-T; RALDH(II); ALDH1A2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, 293T, Mouse liver, Mouse lung, Mouse testis, Rat liver, SW620 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human ALDH1A2 (NP_733797.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MTSSKIEMPGEVKADPAALMASLHLLPSPTPNLEIKYTKIFINNEWQNSESGRVFPVYNPATGEQVCEVQEADKADIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRAVLATMESLNGGKPFLQAFYVDLQGVIKTFRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVC | Uniprot ID | O94788 |
Uniprot Id
O94788
Target Species
Human
Target Name
ALDH1A2
Target Full Name
Retinal dehydrogenase 2
Target Function
Converts retinaldehyde to retinoic acid. Recognizes as substrates free retinal and cellular retinol-binding protein-bound retinal. Can metabolize octanal and decanal, but has only very low activity with benzaldehyde, acetaldehyde and propanal. Displays complete lack of activity with citral.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Aldehyde dehydrogenase family
Target Research Area
Neuroscience
Target Synonyms
AL1A2_HUMAN; Aldehyde dehydrogenase family 1 member A2; ALDH1A2 aldehyde dehydrogenase 1 family; member A2 ; ALDH1A2; Aldh1a7; AV116159; MGC26444; RALDH 2; RALDH(II); Raldh1; RalDH2; RALDH2 T; Retinal dehydrogenase 2; Retinaldehyde dehydrogenase 2 ; Retinaldehyde specific dehydrogenase type 2; Retinaldehyde-specific dehydrogenase type 2
Target Background
This protein belongs to the aldehyde dehydrogenase family of proteins. The product of this gene is an enzyme that catalyzes the synthesis of retinoic acid (RA) from retinaldehyde. Retinoic acid, the active derivative of vitamin A (retinol), is a hormonal signaling molecule that functions in developing and adult tissues. The studies of a similar mouse gene suggest that this enzyme and the cytochrome CYP26A1, concurrently establish local embryonic retinoic acid levels which facilitate posterior organ development and prevent spina bifida. Four transcript variants encoding distinct isoforms have been identified for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
