Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ALDH3B1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human ALDH3B1 (NP_001025181.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ALDH3B1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human ALDH3B1 (NP_001025181.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06445A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ALDH3B1 |
| Target Synonyms | ALDH4; ALDH7; ALDH3B1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, 293T, Mouse liver, Rat lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human ALDH3B1 (NP_001025181.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDPLGDTLRRLREAFHAGRTRPAEFRAAQLQGLGRFLQENKQLLHDALAQDLHKATQLDSAFIRKEPFGLVLIIAPWNYP | Uniprot ID | P43353 |
Uniprot Id
P43353
Target Species
Human
Target Name
ALDH3B1
Target Full Name
Aldehyde dehydrogenase family 3 member B1
Target Function
Oxidizes medium and long chain saturated and unsaturated aldehydes. Metabolizes also benzaldehyde. Low activity towards acetaldehyde and 3,4-dihydroxyphenylacetaldehyde. May not metabolize short chain aldehydes. Can use both NADP(+) and NAD(+) as electron acceptor. May have a protective role against the cytotoxicity induced by lipid peroxidation.
Target Subcellular Location
Cell membrane; Lipid-anchor. Note=Primarily in the plasma membrane as well as in some punctate structures in the cytoplasm.
Target Protein Families
Aldehyde dehydrogenase family
Target Tissue Specificity
Highest expression in kidney and lung.
Target Synonyms
ALDH3B1; ALDH7Aldehyde dehydrogenase family 3 member B1; EC 1.2.1.28; EC 1.2.1.5; EC 1.2.1.7; Aldehyde dehydrogenase 7
Target Background
This gene encodes a member of the aldehyde dehydrogenase protein family. Aldehyde dehydrogenases are a family of isozymes that may play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. The encoded protein is able to oxidize long-chain fatty aldehydes in vitro, and may play a role in protection from oxidative stress. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
