Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ALDH5A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 400-500 of human ALDH5A1 (NP_001071.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ALDH5A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 400-500 of human ALDH5A1 (NP_001071.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
Western blot analysis of Mouse liver, using ALDH5A1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.
| Cat.No | ADA-10010A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ALDH5A1 |
| Target Synonyms | SSDH; SSADH; ALDH5A1 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 400-500 of human ALDH5A1 (NP_001071.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VSKGATVVTGGKRHQLGKNFFEPTLLCNVTQDMLCTHEETFGPLAPVIKFDTEEEAIAIANAADVGLAGYFYSQDPAQIWRVAEQLEVGMVGVNEGLISSV | Uniprot ID | P51649 |
Uniprot Id
P51649
Target Species
Human
Target Name
ALDH5A1
Target Full Name
Succinate-semialdehyde dehydrogenase, mitochondrial
Target Function
Catalyzes one step in the degradation of the inhibitory neurotransmitter gamma-aminobutyric acid (GABA).
Target Involvement
Succinic semialdehyde dehydrogenase deficiency (SSADHD)
Target Subcellular Location
Mitochondrion.
Target Protein Families
Aldehyde dehydrogenase family
Target Tissue Specificity
Brain, pancreas, heart, liver, skeletal muscle and kidney. Lower in placenta.
Target Research Area
Metabolism
Target Synonyms
Aldedehyde dehydrogenase 5 family; Aldehyde dehydrogenase 5 family member A1; Aldehyde dehydrogenase 5A1; Aldehyde dehydrogenase family 5 member A1; ALDH5A 1; Aldh5a1; mitochondrial; Mitochondrial succinate semialdehyde dehydrogenase; NAD(+) dependent succinic semialdehyde dehydrogenase; NAD(+)-dependent succinic semialdehyde dehydrogenase; SSADH; SSDH; SSDH_HUMAN; Succinate semialdehyde dehydrogenase; Succinate-semialdehyde dehydrogenase
Target Background
This protein belongs to the aldehyde dehydrogenase family of proteins. This gene encodes a mitochondrial NAD(+)-dependent succinic semialdehyde dehydrogenase. A deficiency of this enzyme, known as 4-hydroxybutyricaciduria, is a rare inborn error in the metabolism of the neurotransmitter 4-aminobutyric acid (GABA). In response to the defect, physiologic fluids from patients accumulate GHB, a compound with numerous neuromodulatory properties. Two transcript variants encoding distinct isoforms have been identified for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
