Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ALG13 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-167 of human ALG13 (NP_001311219.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ALG13 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-167 of human ALG13 (NP_001311219.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07196A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ALG13 |
| Target Synonyms | CDG1S; DEE36; EIEE36; MDS031; TDRD13; CXorf45; GLT28D1; YGL047W; ALG13 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, HepG2, Jurkat, K-562, Mouse liver, Raji | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-167 of human ALG13 (NP_001311219.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VVINEKLMNNHQLELAKQLHKEGHLFYCTCSTLPGLLQSMDLSTLKCYPPGQPEKFSAFLDKVVGLQK | Uniprot ID | Q9NP73 |
Uniprot Id
Q9NP73
Target Species
Human
Target Name
ALG13
Target Full Name
UDP-N-acetylglucosamine transferase subunit ALG13
Target Function
Possible multifunctional enzyme with both glycosyltransferase and deubiquitinase activities.; May be involved in protein N-glycosylation, second step of the dolichol-linked oligosaccharide pathway.
Target Involvement
Epileptic encephalopathy, early infantile, 36 (EIEE36)
Target Subcellular Location
[Isoform 2]: Endoplasmic reticulum. Note=Could be recruited to the cytosolic face of the endoplasmic reticulum membrane through its interaction with ALG14.
Target Protein Families
Glycosyltransferase 28 family
Target Synonyms
ALG13; ALG13, S. cerevisiae, homolog of; ALG13, UDP-N-acetylglucosaminyltransferase subunit; ALG13_HUMAN; Asparagine linked glycosylation 13 homolog (S. cerevisiae); Asparagine-linked glycosylation 13 homolog; Asparagine-linked glycosylation 13, S. cerevisiae, homolog of; CDG1S; CXorf45; FLJ23018; FLJ31785; GLT28D1; Glycosyltransferase 28 domain containing protein 1 ; Glycosyltransferase 28 domain-containing 1; Glycosyltransferase 28 domain-containing protein 1; Hematopoietic stem/progenitor cells protein MDS031; MDS031; MGC12423; N-acetylglucosaminyldiphosphodolichol N-acetylglucosaminyltransferase; OTTHUMP00000062812; OTTHUMP00000176862; TDRD13; tudor domain containing 13; UDP N acetylglucosamine transferase subunit ALG13 homolog; UDP-N-acetylglucosamine transferase subunit ALG13 homolog; YGL047W
Target Background
The protein encoded by this gene is a subunit of a bipartite UDP-N-acetylglucosamine transferase. It heterodimerizes with asparagine-linked glycosylation 14 homolog to form a functional UDP-GlcNAc glycosyltransferase that catalyzes the second sugar addition of the highly conserved oligosaccharide precursor in endoplasmic reticulum N-linked glycosylation. Multiple transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
