Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ALG5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 34-190 of human ALG5 (NP_037470.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against ALG5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 34-190 of human ALG5 (NP_037470.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-07027A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ALG5 |
| Target Synonyms | PKD7; bA421P11.2; ALG5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, HepG2, U-87MG | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 34-190 of human ALG5 (NP_037470.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPALHRHEEEKFFLNAKGQKETLPSIWDSPTKQLSVVVPSYNEEKRLPVMMDEALSYLEKRQKRDPAFTYEVIVVDDGSKDQTSKVAFKYCQKYGSDKVRVITLVKNRGKGGAIRMGIFSSRGEKILMADADGATKFPDVEKLEKGLNDLQPWPNQM | Uniprot ID | Q9Y673 |
Uniprot Id
Q9Y673
Target Species
Human
Target Name
ALG5
Target Full Name
Dolichyl-phosphate beta-glucosyltransferase
Target Subcellular Location
Endoplasmic reticulum membrane; Single-pass type II membrane protein.
Target Protein Families
Glycosyltransferase 2 family
Target Tissue Specificity
Expressed in pancreas, placenta, liver, heart, brain, kidney, skeletal muscle, and lung.
Target Synonyms
ALG5; HSPC149Dolichyl-phosphate beta-glucosyltransferase; DolP-glucosyltransferase; EC 2.4.1.117; Asparagine-linked glycosylation protein 5 homolog
Target Background
This gene encodes a member of the glycosyltransferase 2 family. The encoded protein participates in glucosylation of the oligomannose core in N-linked glycosylation of proteins. The addition of glucose residues to the oligomannose core is necessary to ensure substrate recognition, and therefore, effectual transfer of the oligomannose core to the nascent glycoproteins. Multiple transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
