-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ALOX12 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 483-663 of human ALOX12 (NP_000688.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against ALOX12 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 483-663 of human ALOX12 (NP_000688.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-11922A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ALOX12 |
| Target Synonyms | LOG12; 12-LOX; 12S-LOX; ALOX12 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-431 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 483-663 of human ALOX12 (NP_000688.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YQRDDIVKGDPELQAWCREITEVGLCQAQDRGFPVSFQSQSQLCHFLTMCVFTCTAQHAAINQGQLDWYAWVPNAPCTMRMPPPTTKEDVTMATVMGSLPDVRQACLQMAISWHLSRRQPDMVPLGHHKEKYFSGPKPKAVLNQFRTDLEKLEKEITARNEQLDWPYEYLKPSCIENSVTI | Uniprot ID | P18054 |
Uniprot Id
P18054
Target Species
Human
Target Name
ALOX12
Target Full Name
Polyunsaturated fatty acid lipoxygenase ALOX12
Target Function
Catalyzes the regio and stereo-specific incorporation of molecular oxygen into free and esterified polyunsaturated fatty acids generating lipid hydroperoxides that can be further reduced to the corresponding hydroxy species. Mainly converts arachidonate ((5Z,8Z,11Z,14Z)-eicosatetraenoate) to the specific bioactive lipid (12S)-hydroperoxyeicosatetraenoate/(12S)-HPETE. Through the production of bioactive lipids like (12S)-HPETE it regulates different biological processes including platelet activation. It can also catalyze the epoxidation of double bonds of polyunsaturated fatty acids such as (14S)-hydroperoxy-docosahexaenoate/(14S)-HPDHA resulting in the formation of (13S,14S)-epoxy-DHA. Furthermore, it may participate in the sequential oxidations of DHA ((4Z,7Z,10Z,13Z,16Z,19Z)-docosahexaenoate) to generate specialized pro-resolving mediators (SPMs) like resolvin D5 ((7S,17S)-diHPDHA) and (7S,14S)-diHPDHA, that actively downregulate the immune response and have anti-aggregation properties with platelets. An additional function involves a multistep process by which it transforms leukotriene A4/LTA4 into the bioactive lipids lipoxin A4/LXA4 and lipoxin B4/LXB4, both are vasoactive and LXA4 may regulate neutrophil function via occupancy of specific recognition sites. Can also peroxidize linoleate ((9Z,12Z)-octadecadienoate) to (13S)-hydroperoxyoctadecadienoate/ (13S-HPODE). Due to its role in regulating both the expression of the vascular endothelial growth factor (VEGF, an angiogenic factor involved in the survival and metastasis of solid tumors) and the expression of integrin beta-1 (known to affect tumor cell migration and proliferation), it can be regarded as protumorigenic. Important for cell survival, as it may play a role not only in proliferation but also in the prevention of apoptosis in vascular smooth muscle cells.
Target Involvement
Esophageal cancer (ESCR); Colorectal cancer (CRC)
Target Subcellular Location
Cytoplasm, cytosol. Membrane. Note=Membrane association is stimulated by EGF.
Target Protein Families
Lipoxygenase family
Target Tissue Specificity
Expressed in vascular smooth muscle cells.
Target Research Area
Cardiovascular
Target Synonyms
12 LOX; 12(S) lipoxygenase ; 12-lipoxygenase; 12LO; 12S LOX; 12S-lipoxygenase; 12S-LOX; 12S-type; Alox12; Arachidonate 12 lipoxygenase; Arachidonate 12 lipoxygenase, 12S type; Arachidonate 12-lipoxygenase; Arachidonate 12-oxidoreductase; Lipoxin synthase 12-LO; LOG12; LOX12_HUMAN; P-12LO; Platelet 12-LOX; Platelet type lipoxygenase 12 ; platelet-type 12-lipoxygenase; Platelet-type lipoxygenase 12
Target Background
This gene encodes a member of the lipoxygenase family of proteins. The encoded enzyme acts on different polyunsaturated fatty acid substrates to generate bioactive lipid mediators including eicosanoids and lipoxins. The encoded enzyme and its reaction products have been shown to regulate platelet function. Elevated expression of this gene has been observed in pancreatic islets derived from human diabetes patients. Allelic variants in this gene may be associated with susceptibility to toxoplasmosis. Multiple pseudogenes of this gene have been identified in the human genome.
Notification