-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ALOX5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human ALOX5 (P09917) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against ALOX5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human ALOX5 (P09917) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-16899A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ALOX5 |
| Target Synonyms | 5-LO; 5LPG; LOG5; 5-LOX; ALOX5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Raji, Rat lung | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human ALOX5 (P09917). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | CYRWITGDVEVVLRDGRAKLARDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQS | Uniprot ID | P09917 |
Uniprot Id
P09917
Target Species
Human
Target Name
ALOX5
Target Full Name
Polyunsaturated fatty acid 5-lipoxygenase
Target Function
Catalyzes the oxygenation of arachidonate ((5Z,8Z,11Z,14Z)-eicosatetraenoate) to 5-hydroperoxyeicosatetraenoate (5-HPETE) followed by the dehydration to 5,6- epoxyeicosatetraenoate (Leukotriene A4/LTA4), the first two steps in the biosynthesis of leukotrienes, which are potent mediators of inflammation. Also catalyzes the oxygenation of arachidonate into 8-hydroperoxyicosatetraenoate (8-HPETE) and 12-hydroperoxyicosatetraenoate (12-HPETE). Displays lipoxin synthase activity being able to convert (15S)-HETE into a conjugate tetraene. Although arachidonate is the preferred substrate, this enzyme can also metabolize oxidized fatty acids derived from arachidonate such as (15S)-HETE, eicosapentaenoate (EPA) such as (18R)- and (18S)-HEPE or docosahexaenoate (DHA) which lead to the formation of specialized pro-resolving mediators (SPM) lipoxin and resolvins E and D respectively, therefore it participates in anti-inflammatory responses. Oxidation of DHA directly inhibits endothelial cell proliferation and sprouting angiogenesis via peroxisome proliferator-activated receptor gamma (PPARgamma). It does not catalyze the oxygenation of linoleic acid and does not convert (5S)-HETE to lipoxin isomers. In addition to inflammatory processes, it participates in dendritic cell migration, wound healing through an antioxidant mechanism based on heme oxygenase-1 (HO-1) regulation expression, monocyte adhesion to the endothelium via ITGAM expression on monocytes. Moreover, it helps establish an adaptive humoral immunity by regulating primary resting B cells and follicular helper T cells and participates in the CD40-induced production of reactive oxygen species (ROS) after CD40 ligation in B cells through interaction with PIK3R1 that bridges ALOX5 with CD40. Also may play a role in glucose homeostasis, regulation of insulin secretion and palmitic acid-induced insulin resistance via AMPK. Can regulate bone mineralization and fat cell differentiation increases in induced pluripotent stem cells.
Target Subcellular Location
Cytoplasm. Nucleus matrix. Nucleus membrane; Peripheral membrane protein. Cytoplasm, perinuclear region. Cytoplasm, cytosol. Nucleus envelope. Nucleus intermembrane space.
Target Protein Families
Lipoxygenase family
Target Research Area
Cancer
Target Synonyms
5 Lipoxygenase; 5 LO; 5 LOX; 5-lipoxygenase; 5-LO; 5-LOX; 5LOX; 5LPG; ALOX 5; Alox5; Arachidonate 5 lipoxygenase; Arachidonate 5-lipoxygenase; arachidonic 5-lipoxygenase alpha-10 isoform; arachidonic 5-lipoxygenase delta-10-13 isoform; arachidonic 5-lipoxygenase delta-13 isoform; arachidonic 5-lipoxygenase delta-p10 isoform; Arachidonic acid 5 lipoxygenase; Leukotriene A4 synthase; LOG 5; LOG5; LOX5_HUMAN; MGC163204
Target Background
This gene encodes a member of the lipoxygenase gene family and plays a dual role in the synthesis of leukotrienes from arachidonic acid. The encoded protein, which is expressed specifically in bone marrow-derived cells, catalyzes the conversion of arachidonic acid to 5(S)-hydroperoxy-6-trans-8, 11, 14-cis-eicosatetraenoic acid, and further to the allylic epoxide 5(S)-trans-7, 9-trans-11, 14-cis-eicosatetrenoic acid (leukotriene A4). Leukotrienes are important mediators of a number of inflammatory and allergic conditions. Mutations in the promoter region of this gene lead to a diminished response to antileukotriene drugs used in the treatment of asthma and may also be associated with atherosclerosis and several cancers. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Notification