-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against alpha 1 Spectrin was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 2300-2400 of human alpha 1 Spectrin (P02549) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against alpha 1 Spectrin was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 2300-2400 of human alpha 1 Spectrin (P02549) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13907A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | alpha 1 Spectrin |
| Target Synonyms | EL2; HPP; HS3; SPH3; SPTA; alpha 1 Spectrin | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat heart, K-562, Mouse lung | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 2300-2400 of human alpha 1 Spectrin (P02549). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LRGLNYYLPMVEEDEHEPKFEKFLDAVDPGRKGYVSLEDYTAFLIDKESENIKSSDEIENAFQALAEGKSYITKEDMKQALTPEQVSFCATHMQQYMDPRG | Uniprot ID | P02549 |
Uniprot Id
P02549
Target Species
Human
Target Name
SPTA1
Target Full Name
Spectrin alpha chain, erythrocytic 1
Target Function
Spectrin is the major constituent of the cytoskeletal network underlying the erythrocyte plasma membrane. It associates with band 4.1 and actin to form the cytoskeletal superstructure of the erythrocyte plasma membrane.
Target Involvement
Elliptocytosis 2 (EL2); Hereditary pyropoikilocytosis (HPP); Spherocytosis 3 (SPH3)
Target Subcellular Location
Cytoplasm, cytoskeleton. Cytoplasm, cell cortex.
Target Protein Families
Spectrin family
Target Research Area
Actin capping, Actin-binding
Target Synonyms
Alpha I spectrin; EL 2; EL2; Elliptocytosis 2; Elliptocytosis2; Erythrocyte alpha spectrin; erythrocyte; Erythroid alpha spectrin; Erythroid alpha-spectrin; Erythroid spectrin alpha; HPP; HS3; Spectrin alpha chain; Spectrin alpha chain erythrocyte; Spectrin alpha erythrocytic 1; SPH3; SPTA 1; SPTA; SPTA1; SPTA1_HUMAN
Target Background
This gene encodes a member of a family of molecular scaffold proteins that link the plasma membrane to the actin cytoskeleton and functions in the determination of cell shape, arrangement of transmembrane proteins, and organization of organelles. The encoded protein is primarily composed of 22 spectrin repeats which are involved in dimer formation. It forms a component of the erythrocyte plasma membrane. Mutations in this gene result in a variety of hereditary red blood cell disorders, including elliptocytosis-2, pyropoikilocytosis, and spherocytosis, type 3.
Notification