-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Alpha-2-Macroglobulin (A2M) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1200-1300 of human Alpha-2-Macroglobulin (A2M) (P01023) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against Alpha-2-Macroglobulin (A2M) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1200-1300 of human Alpha-2-Macroglobulin (A2M) (P01023) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-16222A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Alpha-2-Macroglobulin (A2M) |
| Target Synonyms | A2MD; CPAMD5; FWP007; S863-7; Alpha-2-Macroglobulin (A2M) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Hep G2 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1200-1300 of human Alpha-2-Macroglobulin (A2M) (P01023). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QAPSAEVEMTSYVLLAYLTAQPAPTSEDLTSATNIVKWITKQQNAQGGFSSTQDTVVALHALSKYGAATFTRTGKAAQVTIQSSGTFSSKFQVDNNNRLLL | Uniprot ID | P01023 |
Uniprot Id
P01023
Target Species
Human
Target Name
A2M
Target Full Name
Alpha-2-macroglobulin
Target Function
Is able to inhibit all four classes of proteinases by a unique 'trapping' mechanism. This protein has a peptide stretch, called the 'bait region' which contains specific cleavage sites for different proteinases. When a proteinase cleaves the bait region, a conformational change is induced in the protein which traps the proteinase. The entrapped enzyme remains active against low molecular weight substrates (activity against high molecular weight substrates is greatly reduced). Following cleavage in the bait region, a thioester bond is hydrolyzed and mediates the covalent binding of the protein to the proteinase.
Target Subcellular Location
Secreted.
Target Protein Families
Protease inhibitor I39 (alpha-2-macroglobulin) family
Target Tissue Specificity
Secreted in plasma.
Target Synonyms
A2m; A2MG_HUMAN; Alpha 2 M; Alpha 2M; Alpha-2-M; Alpha-2-macroglobulin; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 5; CPAMD5; DKFZp779B086; FWP007; S863 7
Target Background
The protein encoded by this gene is a protease inhibitor and cytokine transporter. It uses a bait-and-trap mechanism to inhibit a broad spectrum of proteases, including trypsin, thrombin and collagenase. It can also inhibit inflammatory cytokines, and it thus disrupts inflammatory cascades. Mutations in this gene are a cause of alpha-2-macroglobulin deficiency. This gene is implicated in Alzheimer's disease (AD) due to its ability to mediate the clearance and degradation of A-beta, the major component of beta-amyloid deposits. A related pseudogene, which is also located on the p arm of chromosome 12, has been identified.
Notification