-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against alpha Sarcoglycan (SGCA) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 288-387 of human alpha Sarcoglycan (SGCA) (SGCA) (Q16586) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against alpha Sarcoglycan (SGCA) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 288-387 of human alpha Sarcoglycan (SGCA) (SGCA) (Q16586) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-14297A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | alpha Sarcoglycan (SGCA) |
| Target Synonyms | ADL; DAG2; 50DAG; DMDA2; LGMD2D; LGMDR3; SCARMD1; adhalin; alpha Sarcoglycan (SGCA) | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat heart, Rat skeletal muscle | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 288-387 of human alpha Sarcoglycan (SGCA) (SGCA) (Q16586). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VDALVTLLVPLLVALLLTLLLAYVMCCRREGRLKRDLATSDIQMVHHCTIHGNTEELRQMAASREVPRPLSTLPMFNVHTGERLPPRVDSAQVPLILDQH | Uniprot ID | Q16586 |
Uniprot Id
Q16586
Target Species
Human
Target Name
SGCA
Target Full Name
Alpha-sarcoglycan
Target Function
Component of the sarcoglycan complex, a subcomplex of the dystrophin-glycoprotein complex which forms a link between the F-actin cytoskeleton and the extracellular matrix.
Target Involvement
Limb-girdle muscular dystrophy 2D (LGMD2D)
Target Subcellular Location
Cell membrane, sarcolemma; Single-pass type I membrane protein. Cytoplasm, cytoskeleton.
Target Protein Families
Sarcoglycan alpha/epsilon family
Target Tissue Specificity
Most strongly expressed in skeletal muscle. Also expressed in cardiac muscle and, at much lower levels, in lung. In the fetus, most abundant in cardiac muscle and, at lower levels, in lung. Also detected in liver and kidney. Not expressed in brain.
Target Synonyms
50 DAG; 50 kDa dystrophin associated glycoprotein; 50 kDa dystrophin-associated glycoprotein; 50DAG; 50kD DAG; 59kDa; A2; adhalin; ADL; Alpha SG; Alpha-sarcoglycan; Alpha-SG; Asg; DAG2; DMDA2; Dystroglycan 2; Dystroglycan-2; LGMD2D; sarcoglycan, alpha (dystrophin-associated glycoprotein); SCARMD1 ; Sgca; SGCA_HUMAN
Target Background
This gene encodes a component of the dystrophin-glycoprotein complex (DGC), which is critical to the stability of muscle fiber membranes and to the linking of the actin cytoskeleton to the extracellular matrix. Its expression is thought to be restricted to striated muscle. Mutations in this gene result in type 2D autosomal recessive limb-girdle muscular dystrophy. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification