-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Alpha SNAP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 201-295 of human Alpha SNAP (P54920) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Alpha SNAP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 201-295 of human Alpha SNAP (P54920) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14380A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Alpha SNAP |
| Target Synonyms | SNAPA; Alpha SNAP | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, A-549, HepG2, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 201-295 of human Alpha SNAP (P54920). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SAKDYFFKAALCHFCIDMLNAKLAVQKYEELFPAFSDSRECKLMKKLLEAHEEQNVDSYTESVKEYDSISRLDQWLTTMLLRIKKTIQGDEEDLR | Uniprot ID | P54920 |
Uniprot Id
P54920
Target Species
Human
Target Name
NAPA
Target Full Name
Alpha-soluble NSF attachment protein
Target Function
Required for vesicular transport between the endoplasmic reticulum and the Golgi apparatus (Probable). Together with GNA12 promotes CDH5 localization to plasma membrane.
Target Subcellular Location
Cell membrane; Peripheral membrane protein.
Target Protein Families
SNAP family
Target Synonyms
Alpha soluble NSF attachment protein; Alpha-soluble NSF attachment protein; N ethylmaleimide sensitive factor attachment protein alpha; N-ethylmaleimide-sensitive factor attachment protein alpha; napA; NSF attachment protein alpha; SNAA_HUMAN; SNAP alpha; SNAP-alpha; SNAPA
Target Background
This gene encodes a member of the soluble NSF attachment protein (SNAP) family. SNAP proteins play a critical role in the docking and fusion of vesicles to target membranes as part of the 20S NSF-SNAP-SNARE complex. The encoded protein plays a role in the completion of membrane fusion by mediating the interaction of N-ethylmaleimide-sensitive factor (NSF) with the vesicle-associated and membrane-associated SNAP receptor (SNARE) complex, and stimulating the ATPase activity of NSF. Alternatively spliced transcript variants have been observed for this gene.
Notification