-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against AMACR/p504S was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-138 of human AMACR (NP_055139.4) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against AMACR/p504S was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-138 of human AMACR (NP_055139.4) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14899A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | AMACR/p504S |
| Target Synonyms | RM; RACE; CBAS4; P504S; AMACRD; AMACR/p504S | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, LNCaP cells, Mouse liver, Rat kidney, Rat liver | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-138 of human AMACR (NP_055139.4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MALQGISVVELSGLAPGPFCAMVLADFGARVVRVDRPGSRYDVSRLGRGKRSLVLDLKQPRGAAVLRRLCKRSDVLLEPFRRGVMEKLQLGPEILQRENPRLIYARLSGFGQSGSFCRLAGHDINYLALSGVLSKIGR | Uniprot ID | Q9UHK6 |
Uniprot Id
Q9UHK6
Target Species
Human
Target Name
AMACR
Target Full Name
Alpha-methylacyl-CoA racemase
Target Function
Catalyzes the interconversion of (R)- and (S)-stereoisomers of alpha-methyl-branched-chain fatty acyl-CoA esters. Acts only on coenzyme A thioesters, not on free fatty acids, and accepts as substrates a wide range of alpha-methylacyl-CoAs, including pristanoyl-CoA, trihydroxycoprostanoyl-CoA (an intermediate in bile acid synthesis), and arylpropionic acids like the anti-inflammatory drug ibuprofen (2-(4-isobutylphenyl)propionic acid) but neither 3-methyl-branched nor linear-chain acyl-CoAs.
Target Involvement
Alpha-methylacyl-CoA racemase deficiency (AMACRD); Congenital bile acid synthesis defect 4 (CBAS4)
Target Subcellular Location
Peroxisome. Mitochondrion.
Target Protein Families
CaiB/BaiF CoA-transferase family
Target Synonyms
2 arylpropionyl CoA epimerase; 2 methylacyl CoA racemase; 2-methylacyl-CoA racemase; Alpha methylacyl CoA racemase; Alpha methylacyl Coenzyme A racemase; Alpha methylacyl-CoA racemase deficiency; included; Alpha-methylacyl-CoA racemase; Amacr; AMACR deficiency; included; AMACR_HUMAN; CBAS4; Da1-8; EC 5.1.99.4; Macr1; Methylacyl CoA racemase alpha; RACE; RM
Target Background
This gene encodes a racemase. The encoded enzyme interconverts pristanoyl-CoA and C27-bile acylCoAs between their (R)- and (S)-stereoisomers. The conversion to the (S)-stereoisomers is necessary for degradation of these substrates by peroxisomal beta-oxidation. Encoded proteins from this locus localize to both mitochondria and peroxisomes. Mutations in this gene may be associated with adult-onset sensorimotor neuropathy, pigmentary retinopathy, and adrenomyeloneuropathy due to defects in bile acid synthesis. Alternatively spliced transcript variants have been described. Read-through transcription also exists between this gene and the upstream neighboring C1QTNF3 (C1q and tumor necrosis factor related protein 3) gene.
Notification