-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against AMOT was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1000-1084 of human AMOT (NP_001106962.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against AMOT was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1000-1084 of human AMOT (NP_001106962.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07906A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | AMOT |
| Target Synonyms | AMOT; angiomotin | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1000-1084 of human AMOT (NP_001106962.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QTQAPTSAPAVAPTPAPTPTPAVAQAEVPASPATGPGPHRLSIPSLTCNPDKTDGPVFHSNTLERKTPIQILGQEPDAEMVEYLI | Uniprot ID | Q4VCS5 |
Uniprot Id
Q4VCS5
Target Species
Human
Target Name
AMOT
Target Full Name
Angiomotin
Target Function
Plays a central role in tight junction maintenance via the complex formed with ARHGAP17, which acts by regulating the uptake of polarity proteins at tight junctions. Appears to regulate endothelial cell migration and tube formation. May also play a role in the assembly of endothelial cell-cell junctions.
Target Subcellular Location
Cell junction, tight junction. Note=Localized on the cell surface. May act as a transmembrane protein.
Target Protein Families
Angiomotin family
Target Tissue Specificity
Expressed in placenta and skeletal muscle. Found in the endothelial cells of capillaries as well as larger vessels of the placenta.
Target Synonyms
AMOT; AMOT_HUMAN; Angiomotin; Angiomotin p130 isoform; KIAA1071
Target Background
This gene belongs to the motin family of angiostatin binding proteins characterized by conserved coiled-coil domains and C-terminal PDZ binding motifs. The encoded protein is expressed predominantly in endothelial cells of capillaries as well as larger vessels of the placenta where it may mediate the inhibitory effect of angiostatin on tube formation and the migration of endothelial cells toward growth factors during the formation of new blood vessels. Alternative splicing results in multiple transcript variants encoding different isoforms.
Notification