-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ANGPTL4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 26-170 of human ANGPTL4 (NP_647475.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against ANGPTL4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 26-170 of human ANGPTL4 (NP_647475.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-12345A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ANGPTL4 |
| Target Synonyms | NL2; ARP4; FIAF; HARP; PGAR; HFARP; TGQTL; UNQ171; pp1158; ANGPTL4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, Rat lung | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 26-170 of human ANGPTL4 (NP_647475.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQ | Uniprot ID | Q9BY76 |
Uniprot Id
Q9BY76
Target Species
Human
Target Name
ANGPTL4
Target Full Name
Angiopoietin-related protein 4
Target Function
Mediates inactivation of the lipoprotein lipase LPL, and thereby plays a role in the regulation of triglyceride clearance from the blood serum and in lipid metabolism. May also play a role in regulating glucose homeostasis and insulin sensitivity (Probable). Inhibits proliferation, migration, and tubule formation of endothelial cells and reduces vascular leakage. Upon heterologous expression, inhibits the adhesion of endothelial cell to the extracellular matrix (ECM), and inhibits the reorganization of the actin cytoskeleton, formation of actin stress fibers and focal adhesions in endothelial cells that have adhered to ANGPTL4-containing ECM (in vitro). Depending on context, may modulate tumor-related angiogenesis.; Mediates inactivation of the lipoprotein lipase LPL, and thereby plays an important role in the regulation of triglyceride clearance from the blood serum and in lipid metabolism. Has higher activity in LPL inactivation than the uncleaved protein.
Target Subcellular Location
Secreted. Secreted, extracellular space, extracellular matrix.
Target Tissue Specificity
Detected in blood plasma (at protein level). Detected in liver. Detected in white fat tissue and placenta. Expressed at high levels in the placenta, heart, liver, muscle, pancreas and lung but expressed poorly in the brain and kidney.
Target Research Area
Cardiovascular
Target Synonyms
Angiopoietin like 4; Angiopoietin related protein 4; Angiopoietin-like protein 4; Angiopoietin-related protein 4; ANGL4_HUMAN; ANGPT L2; ANGPT L4; ANGPTL2; Angptl4; ARP4; Fasting induced adipose factor; FIAF; HARP; Hepatic angiopoietin related protein; Hepatic fibrinogen/angiopoietin related protein; Hepatic fibrinogen/angiopoietin-related protein; HFARP; NL2; Peroxisome proliferator-activated receptor (PPAR) gamma induced angiopoietin related protein; PGAR; pp1158; PPARG angiopoietin related protein; PSEC0166; TGQTL; UNQ171; Weakly similar to angiopoietin 1 [H.sapiens]
Target Background
This gene encodes a glycosylated, secreted protein containing a C-terminal fibrinogen domain. The encoded protein is induced by peroxisome proliferation activators and functions as a serum hormone that regulates glucose homeostasis, lipid metabolism, and insulin sensitivity. This protein can also act as an apoptosis survival factor for vascular endothelial cells and can prevent metastasis by inhibiting vascular growth and tumor cell invasion. The C-terminal domain may be proteolytically-cleaved from the full-length secreted protein. Decreased expression of this gene has been associated with type 2 diabetes. Alternative splicing results in multiple transcript variants. This gene was previously referred to as ANGPTL2 but has been renamed ANGPTL4.
Notification