Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ANKLE2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 350-450 of human ANKLE2 (NP_055929.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against ANKLE2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 350-450 of human ANKLE2 (NP_055929.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-06998A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ANKLE2 |
| Target Synonyms | Lem4; LEMD7; MCPH16; KIAA0692; ANKLE2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Jurkat, U-87MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 350-450 of human ANKLE2 (NP_055929.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | CRYNVMHVAAKENQASICQLTLDVLENPDFMRLMYPDDDEAMLQKRIRYVVDLYLNTPDKMGYDTPLHFACKFGNADVVNVLSSHHLIVKNSRNKYDKTPE | Uniprot ID | Q86XL3 |
Uniprot Id
Q86XL3
Target Species
Human
Target Name
ANKLE2
Target Full Name
Ankyrin repeat and LEM domain-containing protein 2
Target Function
Involved in mitotic nuclear envelope reassembly by promoting dephosphorylation of BAF/BANF1 during mitotic exit. Coordinates the control of BAF/BANF1 dephosphorylation by inhibiting VRK1 kinase and promoting dephosphorylation of BAF/BANF1 by protein phosphatase 2A (PP2A), thereby facilitating nuclear envelope assembly. May regulate nuclear localization of VRK1 in non-dividing cells. It is unclear whether it acts as a real PP2A regulatory subunit or whether it is involved in recruitment of the PP2A complex. Involved in brain development.
Target Involvement
Microcephaly 16, primary, autosomal recessive (MCPH16)
Target Subcellular Location
Endoplasmic reticulum membrane; Single-pass type III membrane protein.
Target Protein Families
ANKLE2 family
Target Synonyms
ANKL2_HUMAN; ANKLE 2 ; ANKLE2; ankyrin repeat and LEM domain containing 2; Ankyrin repeat and LEM domain-containing protein 2; FLJ 22280; FLJ 36132; FLJ22280; FLJ36132; KIAA 0692; KIAA0692; LEM domain containing 7; LEM domain-containing protein 4; LEMD 7 ; LEMD7
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
