Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ANO6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 750-830 of human ANO6 (NP_001020527.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ANO6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 750-830 of human ANO6 (NP_001020527.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02145A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ANO6 |
| Target Synonyms | SCTS; BDPLT7; TMEM16F; ANO6 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, A-549, Mouse liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 750-830 of human ANO6 (NP_001020527.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IPRLVYYWSFSVPPYGDHTSYTMEGYINNTLSIFKVADFKNKSKGNPYSDLGNHTTCRYRDFRYPPGHPQEYKHNIYYWHV | Uniprot ID | Q4KMQ2 |
Uniprot Id
Q4KMQ2
Target Species
Human
Target Name
ANO6
Target Full Name
Anoctamin-6
Target Function
Small-conductance calcium-activated nonselective cation (SCAN) channel which acts as a regulator of phospholipid scrambling in platelets and osteoblasts. Phospholipid scrambling results in surface exposure of phosphatidylserine which in platelets is essential to trigger the clotting system whereas in osteoblasts is essential for the deposition of hydroxyapatite during bone mineralization. Has calcium-dependent phospholipid scramblase activity; scrambles phosphatidylserine, phosphatidylcholine and galactosylceramide. Can generate outwardly rectifying chloride channel currents in airway epithelial cells and Jurkat T lymphocytes.; Upon SARS coronavirus-2/SARS-CoV-2 infection, is activated by spike protein which increases the amplitude of spontaneous Ca(2+) signals and is required for spike-mediated syncytia.
Target Involvement
Scott syndrome (SCTS)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Note=Shows an intracellular localization according to PubMed:22075693.
Target Protein Families
Anoctamin family
Target Tissue Specificity
Expressed in embryonic stem cell, fetal liver, retina, chronic myologenous leukemia and intestinal cancer.
Target Synonyms
2900059G15Rik; AA407480; Ano6; ANO6_HUMAN; Anoctamin 6; Anoctamin-6; AW554778; BDPLT7; F730003B03Rik; MGC104751; SCTS; TMEM16F; Transmembrane protein 16F
Target Background
This gene encodes a multi-pass transmembrane protein that belongs to the anoctamin family. This protein is an essential component for the calcium-dependent exposure of phosphatidylserine on the cell surface. The scrambling of phospholipid occurs in various biological systems, such as when blood platelets are activated, they expose phosphatidylserine to trigger the clotting system. Mutations in this gene are associated with Scott syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
