-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ANP32B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human ANP32B (Q92688) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against ANP32B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human ANP32B (Q92688) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-14165A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ANP32B |
| Target Synonyms | APRIL; SSP29; PHAPI2; ANP32B | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A549, Mouse testis, PC-3, RAW264.7, U-937 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ANP32B (Q92688). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDMKRRIHLELRNRTPAAVRELVLDNCKSNDGKIEGLTAEFVNLEFLSLINVGLISVSNLPKLPKLKKLELSENRIFGGLDMLAEKLPNLTHLNLSGNKL | Uniprot ID | Q92688 |
Uniprot Id
Q92688
Target Species
Human
Target Name
ANP32B
Target Full Name
Acidic leucine-rich nuclear phosphoprotein 32 family member B
Target Function
Multifunctional protein that is involved in the regulation of many processes including cell proliferation, apoptosis, cell cycle progression or transcription. Regulates the proliferation of neuronal stem cells, differentiation of leukemic cells and progression from G1 to S phase of the cell cycle. As negative regulator of caspase-3-dependent apoptosis, may act as an antagonist of ANP32A in regulating tissue homeostasis. Exhibits histone chaperone properties, able to recruit histones to certain promoters, thus regulating the transcription of specific genes. Plays also an essential role in the nucleocytoplasmic transport of specific mRNAs via the uncommon nuclear mRNA export receptor XPO1/CRM1. Participates in the regulation of adequate adaptive immune responses by acting on mRNA expression and cell proliferation.; (Microbial infection) Plays an essential role in influenza A and B viral genome replication. Plays also a role in foamy virus mRNA export from the nucleus to the cytoplasm.
Target Subcellular Location
[Isoform 1]: Nucleus. Cytoplasm.; [Isoform 2]: Cytoplasm. Note=Lacks a nuclear localization signal.
Target Protein Families
ANP32 family
Target Tissue Specificity
Expressed in heart, lung, pancreas, prostate and in spleen, thymus and placenta.
Target Synonyms
Acidic (leucine rich) nuclear phosphoprotein 32 family member B; Acidic leucine rich nuclear phosphoprotein 32 family member B; Acidic leucine-rich nuclear phosphoprotein 32 family member B; Acidic nuclear phosphoprotein 32 family member B; Acidic protein rich in leucines; AN32B_HUMAN; ANP 32B; ANP32B; APRIL; OTTHUMP0000006377; PAL 31; PAL31; PHAPI 2; PHAPI2; PHAPI2 protein; PHAPI2a; Proliferation related acidic leucine rich protein; Putative HLA-DR-associated protein I-2; Silver stainable protein SSP 29; Silver stainable protein SSP29; Silver-stainable protein SSP29; Ssp 29; Ssp29
Target Background
Enables RNA polymerase binding activity and histone binding activity. Involved in several processes, including activation of cysteine-type endopeptidase activity involved in apoptotic process; nucleosome assembly; and positive regulation of protein export from nucleus. Located in cytoplasm and nucleoplasm. Colocalizes with nucleolus.
Notification