Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ANXA9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human ANXA9 (NP_003559.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ANXA9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human ANXA9 (NP_003559.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06940A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ANXA9 |
| Target Synonyms | ANX31; ANXA9 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-431, HepG2 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human ANXA9 (NP_003559.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSVTGGKMAPSLTQEILSHLGLASKTAAWGTLGTLRTFLNFSVDKDAQRLLRAITGQGVDRSAIVDVLTNRSREQRQLISRNFQERTQQDLMKSLQAALS | Uniprot ID | O76027 |
Uniprot Id
O76027
Target Species
Human
Target Name
ANXA9
Target Full Name
Annexin A9
Target Function
Low affinity receptor for acetylcholine known to be targeted by disease-causing pemphigus vulgaris antibodies in keratinocytes.
Target Protein Families
Annexin family
Target Tissue Specificity
Expressed in the stratified squamous skin epithelium, but not in epithelia of other types (at protein level).
Target Research Area
Signal Transduction
Target Synonyms
annexin 31; annexin 31; formerly; Annexin A9; Annexin XXXI; Annexin-31; Annexin-9; ANX31; ANX31; formerly; ANXA9; ANXA9_HUMAN; Pemphaxin
Target Background
The annexins are a family of calcium-dependent phospholipid-binding proteins. Members of the annexin family contain 4 internal repeat domains, each of which includes a type II calcium-binding site. The calcium-binding sites are required for annexins to aggregate and cooperatively bind anionic phospholipids and extracellular matrix proteins. This gene encodes a divergent member of the annexin protein family in which all four homologous type II calcium-binding sites in the conserved tetrad core contain amino acid substitutions that ablate their function. However, structural analysis suggests that the conserved putative ion channel formed by the tetrad core is intact.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
