-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against AP1G1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 723-822 of human AP1G1 (O43747) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against AP1G1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 723-822 of human AP1G1 (O43747) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14355A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | AP1G1 |
| Target Synonyms | ADTG; CLAPG1; USRISD; AP1G1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, 293T, HepG2, Mouse brain, Mouse liver, Rat liver | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 723-822 of human AP1G1 (O43747). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RSNTNPSVTVITIQASNSTELDMTDFVFQAAVPKTFQLQLLSPSSSIVPAFNTGTITQVIKVLNPQKQQLRMRIKLTYNHKGSAMQDLAEVNNFPPQSWQ | Uniprot ID | O43747 |
Uniprot Id
O43747
Target Species
Human
Target Name
AP1G1
Target Full Name
AP-1 complex subunit gamma-1
Target Function
Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules. In association with AFTPH/aftiphilin in the aftiphilin/p200/gamma-synergin complex, involved in the trafficking of transferrin from early to recycling endosomes, and the membrane trafficking of furin and the lysosomal enzyme cathepsin D between the trans-Golgi network (TGN) and endosomes.
Target Subcellular Location
Golgi apparatus. Cytoplasmic vesicle, clathrin-coated vesicle membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasm. Cytoplasm, perinuclear region. Cytoplasmic vesicle, clathrin-coated vesicle.
Target Protein Families
Adaptor complexes large subunit family
Target Tissue Specificity
Widely expressed.
Target Synonyms
Adapter-related protein complex 1 subunit gamma-1; Adaptor protein complex AP 1 gamma 1 subunit; Adaptor protein complex AP 1 subunit gamma 1; Adaptor protein complex AP-1 subunit gamma-1; Adaptor related protein complex 1 gamma 1 subunit; ADTG; AP 1 complex subunit gamma 1; AP-1 complex subunit gamma-1; AP1G1; AP1G1_HUMAN; CLAPG1; Clathrin assembly protein complex 1 gamma 1 large chain; Clathrin assembly protein complex 1 gamma large chain; Clathrin assembly protein complex 1 gamma-1 large chain; Clathrin associated/assembly/adaptor protein large gamma 1; Gamma1 adaptin; Gamma1-adaptin; Golgi adaptor HA1/AP1 adaptin gamma subunit; Golgi adaptor HA1/AP1 adaptin subunit gamma 1; Golgi adaptor HA1/AP1 adaptin subunit gamma-1; MGC18255
Target Background
Adaptins are important components of clathrin-coated vesicles transporting ligand-receptor complexes from the plasma membrane or from the trans-Golgi network to lysosomes. The adaptin family of proteins is composed of four classes of molecules named alpha, beta-, beta prime- and gamma- adaptins. Adaptins, together with medium and small subunits, form a heterotetrameric complex called an adaptor, whose role is to promote the formation of clathrin-coated pits and vesicles. The protein encoded by this gene is a gamma-adaptin protein and it belongs to the adaptor complexes large subunits family. Two transcript variants encoding different isoforms have been found for this gene.
Notification