-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against AP2B1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 752-951 of human AP2B1 (NP_001025177.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against AP2B1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 752-951 of human AP2B1 (NP_001025177.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-04437A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | AP2B1 |
| Target Synonyms | ADTB2; AP105B; CLAPB1; AP2-BETA; AP2B1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, K-562, Mouse brain, Mouse lung, Mouse testis, Rat testis | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 752-951 of human AP2B1 (NP_001025177.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN | Uniprot ID | P63010 |
Uniprot Id
P63010
Target Species
Human
Target Name
AP2B1
Target Full Name
AP-2 complex subunit beta
Target Function
Component of the adaptor protein complex 2 (AP-2). Adaptor protein complexes function in protein transport via transport vesicles in different membrane traffic pathways. Adaptor protein complexes are vesicle coat components and appear to be involved in cargo selection and vesicle formation. AP-2 is involved in clathrin-dependent endocytosis in which cargo proteins are incorporated into vesicles surrounded by clathrin (clathrin-coated vesicles, CCVs) which are destined for fusion with the early endosome. The clathrin lattice serves as a mechanical scaffold but is itself unable to bind directly to membrane components. Clathrin-associated adaptor protein (AP) complexes which can bind directly to both the clathrin lattice and to the lipid and protein components of membranes are considered to be the major clathrin adaptors contributing the CCV formation. AP-2 also serves as a cargo receptor to selectively sort the membrane proteins involved in receptor-mediated endocytosis. AP-2 seems to play a role in the recycling of synaptic vesicle membranes from the presynaptic surface. AP-2 recognizes Y-X-X-[FILMV] (Y-X-X-Phi) and [ED]-X-X-X-L-[LI] endocytosis signal motifs within the cytosolic tails of transmembrane cargo molecules. AP-2 may also play a role in maintaining normal post-endocytic trafficking through the ARF6-regulated, non-clathrin pathway. During long-term potentiation in hippocampal neurons, AP-2 is responsible for the endocytosis of ADAM10. The AP-2 beta subunit acts via its C-terminal appendage domain as a scaffolding platform for endocytic accessory proteins; at least some clathrin-associated sorting proteins (CLASPs) are recognized by their [DE]-X(1,2)-F-X-X-[FL]-X-X-X-R motif. The AP-2 beta subunit binds to clathrin heavy chain, promoting clathrin lattice assembly; clathrin displaces at least some CLASPs from AP2B1 which probably then can be positioned for further coat assembly.
Target Subcellular Location
Cell membrane. Membrane, coated pit; Peripheral membrane protein; Cytoplasmic side. Note=AP-2 appears to be excluded from internalizing CCVs and to disengage from sites of endocytosis seconds before internalization of the nascent CCV.
Target Protein Families
Adaptor complexes large subunit family
Target Tissue Specificity
Expressed in the brain (at protein level).
Target Synonyms
Adapter related protein complex 2 beta 1 subunit; Adapter-related protein complex 2 beta subunit; Adaptin, beta 2 (beta); Adaptor protein complex AP-2 subunit beta; Adaptor related protein complex 2, beta 1 subunit; ADTB2; AP-2 complex subunit beta; AP105B; AP2 BETA; Ap2b1; AP2B1_HUMAN; Beta adaptin; Beta-2-adaptin; Beta-adaptin; Beta2 adaptin; CLAPB1; Clathrin assembly protein complex 2 beta large chain; Clathrin associated/assembly/adaptor protein, large, beta 1; DKFZp781K0743; Plasma membrane adaptor HA2/AP2 adaptin beta subunit
Target Background
The protein encoded by this gene is one of two large chain components of the assembly protein complex 2, which serves to link clathrin to receptors in coated vesicles. The encoded protein is found on the cytoplasmic face of coated vesicles in the plasma membrane. Two transcript variants encoding different isoforms have been found for this gene.
Notification