-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against APC was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 27-220 of human CD48(NP_001769.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on FC.
The antibody against APC was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 27-220 of human CD48(NP_001769.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on FC.
| Cat.No | ADA-07981A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | APC |
| Target Synonyms | BCM1; BLAST; hCD48; mCD48; BLAST1; SLAMF2; MEM-102 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 0.2% BSA, PBS with 0.03% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | FC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 27-220 of human CD48(NP_001769.2) | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARS | Uniprot ID | P09326 |
Uniprot Id
P09326
Target Species
Human
Target Name
CD48
Target Full Name
CD48 antigen
Target Function
Ligand for CD2. Might facilitate interaction between activated lymphocytes. Probably involved in regulating T-cell activation.
Target Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor.
Target Research Area
Immunology
Target Synonyms
Antigen CD48; B cell membrane protein; B lymphocyte activation marker BLAST 1; B-cell activation marker; B-lymphocyte activation marker BLAST-1; BCM 1 surface antigen; BCM1; BCM1 surface antigen; BLAST 1; BLAST; BLAST1; CD 48; CD48; CD48 antigen (B cell membrane protein); CD48 antigen; CD48 molecule; CD48 protein; CD48_HUMAN; hCD48; Leucocyte antigen MEM 102; Leukocyte antigen MEM-102; mCD48; MEM 102; MEM-102; MEM102 ; Signaling lymphocytic activation molecule 2; SLAM family member 2; SLAMF 2; SLAMF2 ; TCT.1
Target Background
This gene encodes a member of the CD2 subfamily of immunoglobulin-like receptors which includes SLAM (signaling lymphocyte activation molecules) proteins. The encoded protein is found on the surface of lymphocytes and other immune cells, dendritic cells and endothelial cells, and participates in activation and differentiation pathways in these cells. The encoded protein does not have a transmembrane domain, however, but is held at the cell surface by a GPI anchor via a C-terminal domain which maybe cleaved to yield a soluble form of the receptor. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification