Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against APC was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 63-234 of human CD153 (NP_001235.1?) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on FC.
The antibody against APC was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 63-234 of human CD153 (NP_001235.1?) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on FC.
| Cat.No | ADA-08413A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | APC |
| Target Synonyms | CD153; CD30L; CD30LG; TNLG3A | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 0.2% BSA, PBS with 0.03% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | FC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 63-234 of human CD153 (NP_001235.1?). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD | Uniprot ID | P32971 |
Uniprot Id
P32971
Target Species
Human
Target Name
TNFSF8
Target Full Name
Tumor necrosis factor ligand superfamily member 8
Target Function
Cytokine that binds to TNFRSF8/CD30. Induces proliferation of T-cells.
Target Subcellular Location
Membrane; Single-pass type II membrane protein.
Target Protein Families
Tumor necrosis factor family
Target Synonyms
TNFSF8; CD30L; CD30LG; Tumor necrosis factor ligand superfamily member 8; CD30 ligand; CD30-L; CD antigen CD153
Target Background
The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF8/CD30, which is a cell surface antigen and a marker for Hodgkin lymphoma and related hematologic malignancies. The engagement of this cytokine expressed on B cell surface plays an inhibitory role in modulating Ig class switch. This cytokine was shown to enhance cell proliferation of some lymphoma cell lines, while to induce cell death and reduce cell proliferation of other lymphoma cell lines. The pleiotropic biologic activities of this cytokine on different CD30+ lymphoma cell lines may play a pathophysiologic role in Hodgkin's and some non-Hodgkin's lymphomas. Two transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
