-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against APOA5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 207-366 of human APOA5 (NP_443200.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against APOA5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 207-366 of human APOA5 (NP_443200.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05782A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | APOA5 |
| Target Synonyms | RAP3; APOAV; APOA5 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 207-366 of human APOA5 (NP_443200.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QELHRSVAPHAPASPARLSRCVQVLSRKLTLKAKALHARIQQNLDQLREELSRAFAGTGTEEGAGPDPQMLSEEVRQRLQAFRQDTYLQIAAFTRAIDQETEEVQQQLAPPPPGHSAFAPEFQQTDSGKVLSKLQARLDDLWEDITHSLHDQGHSHLGDP | Uniprot ID | Q6Q788 |
Uniprot Id
Q6Q788
Target Species
Human
Target Name
APOA5
Target Full Name
Apolipoprotein A-V
Target Function
Minor apolipoprotein mainly associated with HDL and to a lesser extent with VLDL. May also be associated with chylomicrons. Important determinant of plasma triglyceride (TG) levels by both being a potent stimulator of apo-CII lipoprotein lipase (LPL) TG hydrolysis and an inhibitor of the hepatic VLDL-TG production rate (without affecting the VLDL-apoB production rate). Activates poorly lecithin:cholesterol acyltransferase (LCAT) and does not enhance efflux of cholesterol from macrophages. Binds heparin.
Target Involvement
Hypertriglyceridemia, familial (FHTR); Hyperlipoproteinemia 5 (HLPP5)
Target Subcellular Location
Secreted. Early endosome. Late endosome. Golgi apparatus, trans-Golgi network.
Target Protein Families
Apolipoprotein A1/A4/E family
Target Tissue Specificity
Liver and plasma.
Target Research Area
Cancer
Target Synonyms
Apo-AV; ApoA-V; Apoa5; APOA5_HUMAN; ApoAV; Apolipoprotein A-V; Apolipoprotein A5; RAP3; Regeneration associated protein 3; Regeneration-associated protein 3
Target Background
The protein encoded by this gene is an apolipoprotein that plays an important role in regulating the plasma triglyceride levels, a major risk factor for coronary artery disease. It is a component of high density lipoprotein and is highly similar to a rat protein that is upregulated in response to liver injury. Mutations in this gene have been associated with hypertriglyceridemia and hyperlipoproteinemia type 5. This gene is located proximal to the apolipoprotein gene cluster on chromosome 11q23. Alternatively spliced transcript variants encoding the same protein have been identified.
Notification