-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ApoER2/LRP8 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 900 to the C-terminus of human ApoER2/ApoER2/LRP8 (NP_004622.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against ApoER2/LRP8 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 900 to the C-terminus of human ApoER2/ApoER2/LRP8 (NP_004622.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-09094A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ApoER2/LRP8 |
| Target Synonyms | MCI1; LRP-8; APOER2; HSZ75190; ApoER2/LRP8 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat testis, SH-SY5Y | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 900 to the C-terminus of human ApoER2/ApoER2/LRP8 (NP_004622.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PLWAEPCLGETREPEDPAPALKELFVLPGEPRSQLHQLPKNPLSELPVVKSKRVALSLEDDGLP | Uniprot ID | Q14114 |
Uniprot Id
Q14114
Target Species
Human
Target Name
LRP8
Target Full Name
Low-density lipoprotein receptor-related protein 8
Target Function
Cell surface receptor for Reelin (RELN) and apolipoprotein E (apoE)-containing ligands. LRP8 participates in transmitting the extracellular Reelin signal to intracellular signaling processes, by binding to DAB1 on its cytoplasmic tail. Reelin acts via both the VLDL receptor (VLDLR) and LRP8 to regulate DAB1 tyrosine phosphorylation and microtubule function in neurons. LRP8 has higher affinity for Reelin than VLDLR. LRP8 is thus a key component of the Reelin pathway which governs neuronal layering of the forebrain during embryonic brain development. Binds the endoplasmic reticulum resident receptor-associated protein (RAP). Binds dimers of beta 2-glycoprotein I and may be involved in the suppression of platelet aggregation in the vasculature. Highly expressed in the initial segment of the epididymis, where it affects the functional expression of clusterin and phospholipid hydroperoxide glutathione peroxidase (PHGPx), two proteins required for sperm maturation. May also function as an endocytic receptor. Not required for endocytic uptake of SEPP1 in the kidney which is mediated by LRP2. Together with its ligand, apolipoprotein E (apoE), may indirectly play a role in the suppression of the innate immune response by controlling the survival of myeloid-derived suppressor cells.
Target Involvement
Myocardial infarction 1 (MCI1)
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Secreted.
Target Protein Families
LDLR family
Target Tissue Specificity
Expressed mainly in brain and placenta. Also expressed in platelets and megakaryocytic cells. Not expressed in the liver.
Target Synonyms
APOER2; Apolipoprotein E receptor 2; low density lipoprotein receptor-related protein 8; Low-density lipoprotein receptor-related protein 8; LRP-8; LRP8; LRP8_HUMAN
Target Background
This gene encodes a member of the low density lipoprotein receptor (LDLR) family. Low density lipoprotein receptors are cell surface proteins that play roles in both signal transduction and receptor-mediated endocytosis of specific ligands for lysosomal degradation. The encoded protein plays a critical role in the migration of neurons during development by mediating Reelin signaling, and also functions as a receptor for the cholesterol transport protein apolipoprotein E. Expression of this gene may be a marker for major depressive disorder. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Notification