-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against APOL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 303-398 of human APOL1 (O14791) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against APOL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 303-398 of human APOL1 (O14791) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-13864A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | APOL1 |
| Target Synonyms | APOL; APO-L; FSGS4; APOL-I; APOL1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, Human plasma, LO2 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 303-398 of human APOL1 (O14791). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RPRVTEPISAESGEQVERVNEPSILEMSRGVKLTDVAPVSFFLVLDVVYLVYESKHLHEGAKSETAEELKKVAQELEEKLNILNNNYKILQADQEL | Uniprot ID | O14791 |
Uniprot Id
O14791
Target Species
Human
Target Name
APOL1
Target Full Name
Apolipoprotein L1
Target Function
May play a role in lipid exchange and transport throughout the body. May participate in reverse cholesterol transport from peripheral cells to the liver.
Target Involvement
Focal segmental glomerulosclerosis 4 (FSGS4)
Target Subcellular Location
Secreted.
Target Protein Families
Apolipoprotein L family
Target Tissue Specificity
Plasma. Found on APOA-I-containing high density lipoprotein (HDL3). Expressed in pancreas, lung, prostate, liver, placenta and spleen.
Target Synonyms
APO L; Apo-L; ApoL; APOL I; ApoL-I; APOL1; APOL1_HUMAN; APOLI; Apolipoprotein L; Apolipoprotein L I; Apolipoprotein L-I; Apolipoprotein L1; FSGS4
Target Background
This gene encodes a secreted high density lipoprotein which binds to apolipoprotein A-I. Apolipoprotein A-I is a relatively abundant plasma protein and is the major apoprotein of HDL. It is involved in the formation of most cholesteryl esters in plasma and also promotes efflux of cholesterol from cells. This apolipoprotein L family member may play a role in lipid exchange and transport throughout the body, as well as in reverse cholesterol transport from peripheral cells to the liver. Several different transcript variants encoding different isoforms have been found for this gene.
Notification