-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against AQP10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 209-301 of human AQP10 (NP_536354.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against AQP10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 209-301 of human AQP10 (NP_536354.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04247A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | AQP10 |
| Target Synonyms | AQPA_HUMAN; AQP10 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, HT-29, K-562, Mouse stomach | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 209-301 of human AQP10 (NP_536354.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | CGIPLNPARDLGPRLFTYVAGWGPEVFSAGNGWWWVPVVAPLVGATVGTATYQLLVALHHPEGPEPAQDLVSAQHKASELETPASAQMLECKL | Uniprot ID | Q96PS8 |
Uniprot Id
Q96PS8
Target Species
Human
Target Name
AQP10
Target Full Name
Aquaporin-10
Target Function
Water channel that mediates water transport across cell membranes irrespective of the cytosolic pH. The channel is permeable to glycerol, especially when the cytosolic pH is acidified. Contributes to adipocyte water and glycerol permeability, and may thereby contribute to the utilization of glycerol derived from phospholipid degradation. May contribute to water transport in the intestine (Probable).; Water channel that mediates water transport across cell membranes, but that is not permeable to glycerol.
Target Subcellular Location
Apical cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Lipid droplet.
Target Protein Families
MIP/aquaporin (TC 1.A.8) family
Target Tissue Specificity
Detected in epithelial cells on villi in the ileum, and also in stomach, jejunum, colon, rectum, white adipose tissue and placenta (at protein level). Expressed in duodenum and jejunum. Highest expression in absorptive epithelial cells at the tips of vill
Target Synonyms
AQP10; Aquaporin-10; AQP-10; Aquaglyceroporin-10; Small intestine aquaporin
Target Background
This gene encodes a member of the aquaglyceroporin family of integral membrane proteins. Members of this family function as water-permeable channels in the epithelia of organs that absorb and excrete water. This protein was shown to function as a water-selective channel, and could also permeate neutral solutes such as glycerol and urea.
Notification