-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against AQP2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 147-271 of human AQP2 (NP_000477.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against AQP2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 147-271 of human AQP2 (NP_000477.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-12164A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | AQP2 |
| Target Synonyms | NDI2; AQP-CD; WCH-CD; AQP2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 147-271 of human AQP2 (NP_000477.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ASTDERRGENPGTPALSIGFSVALGHLLGIHYTGCSMNPARSLAPAVVTGKFDDHWVFWIGPLVGAILGSLLYNYVLFPPAKSLSERLAVLKGLEPDTDWEEREVRRRQSVELHSPQSLPRGTKA | Uniprot ID | P41181 |
Uniprot Id
P41181
Target Species
Human
Target Name
AQP2
Target Full Name
Aquaporin-2
Target Function
Forms a water-specific channel that provides the plasma membranes of renal collecting duct with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient. Plays an essential role in renal water homeostasis.
Target Involvement
Diabetes insipidus, nephrogenic, autosomal (ANDI)
Target Subcellular Location
Apical cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane; Multi-pass membrane protein. Golgi apparatus, trans-Golgi network membrane; Multi-pass membrane protein.
Target Protein Families
MIP/aquaporin (TC 1.A.8) family
Target Tissue Specificity
Expressed in collecting tubules in kidney medulla (at protein level). Detected in kidney.
Target Research Area
Signal Transduction
Target Synonyms
AQP2; Aquaporin-2; AQP-2; ADH water channel; Aquaporin-CD; AQP-CD; Collecting duct water channel protein; WCH-CD; Water channel protein for renal collecting duct
Target Background
This gene encodes a water channel protein located in the kidney collecting tubule. It belongs to the MIP/aquaporin family, some members of which are clustered together on chromosome 12q13. Mutations in this gene have been linked to autosomal dominant and recessive forms of nephrogenic diabetes insipidus.
Notification